DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and Zfp53

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_038871.1 Gene:Zfp53 MGIID:99200 Length:652 Species:Mus musculus

Alignment Length:420 Identity:131/421 (31%)
Similarity:201/421 (48%) Gaps:43/421 (10%)


  Fly     5 RRSVSKEDAVSLL-------TDSGISL-SSPPAARESSPGPTLAIKRRKSSLASLRDACVDEEED 61
            |.|..::.:|.||       |.:|..| .|....:..|....|...:|..:...|:         
Mouse   144 RCSKDRDGSVDLLNQDRHKSTHTGEELCKSEDCEKSLSLSSNLTENQRLYAANKLQ--------- 199

  Fly    62 DGGEQDSKDDDY--VQPQLKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCK 124
               .|...|||:  |...::::...|:    ..|.|.:|.|.|...:.|..|..||:.::|:||.
Mouse   200 ---SQGEYDDDFSSVYSLMQQTIYIGD----TPHQCEKCRKCFSTASSLTVHKRIHTGKKPYKCS 257

  Fly   125 DCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFAR 189
            .||||:.|..|||.| ...|...|.:.|.:|.|||.....|:.|.::|:||:||.|..|||.||.
Mouse   258 VCGKSFTQCTNLKTH-QRLHTGEKPYKCKECGKSFPQLSALKSHQKIHTGERPYKCKECDKSFAH 321

  Fly   190 GGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRAH 254
            ....::|..:|.  :.:..:|.:|.......::||.|...|.....::|:.|:..|....:.|.|
Mouse   322 CSSFRRHQKTHR--AEEHCSCPECGKVLHQLSHLRSHYRLHTGEKPYKCNECDRSFTYYASYRRH 384

  Fly   255 INQEHHKLTQF-ECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGE 318
              |:.|.|.:| :|:.|.|.......|..|.:.||..|.:.||||:..||..|....|:::||||
Mouse   385 --QKTHSLDKFYKCKECGKSFLELSHLKRHYRIHTGEKPYKCEVCDKSFTVNSTLKTHLKIHTGE 447

  Fly   319 RPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCE 383
            :|::||.|.::|...|.|:.|...||||||:||:.|:.  :|::.:.|:.| :|||..:|||.|.
Mouse   448 KPFKCRECDKSFTKCSHLRRHQSVHTGEKPYRCKECDK--SFTECSTLRAH-QKIHTGEKPYKCR 509

  Fly   384 GCHDFFKIKVELQSHVE-H-------CAKC 405
            .|...|..:..|..|.. |       |.:|
Mouse   510 ECDKSFIQRSNLIIHQRVHTGERPYICKEC 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 52/159 (33%)
C2H2 Zn finger 95..115 CDD:275368 7/20 (35%)
zf-H2C2_2 107..132 CDD:290200 11/25 (44%)
C2H2 Zn finger 123..144 CDD:275368 10/21 (48%)
C2H2 Zn finger 152..172 CDD:275368 7/20 (35%)
zf-H2C2_2 165..189 CDD:290200 13/24 (54%)
C2H2 Zn finger 180..200 CDD:275368 7/20 (35%)
COG5048 <192..369 CDD:227381 56/178 (31%)
C2H2 Zn finger 210..230 CDD:275370 5/20 (25%)
C2H2 Zn finger 238..260 CDD:275371 6/22 (27%)
C2H2 Zn finger 267..287 CDD:275368 5/20 (25%)
C2H2 Zn finger 295..315 CDD:275368 8/20 (40%)
zf-H2C2_2 309..332 CDD:290200 10/23 (43%)
C2H2 Zn finger 323..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 351..374 CDD:275368 7/23 (30%)
C2H2 Zn finger 382..399 CDD:275368 5/17 (29%)
Zfp53NP_038871.1 KRAB 54..>99 CDD:214630
KRAB 54..93 CDD:279668
COG5048 223..627 CDD:227381 112/330 (34%)
C2H2 Zn finger 228..248 CDD:275368 7/20 (35%)
zf-H2C2_2 240..265 CDD:290200 11/25 (44%)
C2H2 Zn finger 256..276 CDD:275368 10/21 (48%)
zf-H2C2_2 268..291 CDD:290200 10/24 (42%)
C2H2 Zn finger 284..304 CDD:275368 7/20 (35%)
zf-H2C2_2 296..321 CDD:290200 13/25 (52%)
C2H2 Zn finger 312..332 CDD:275368 7/20 (35%)
C2H2 Zn finger 340..360 CDD:275368 5/20 (25%)
zf-H2C2_2 352..377 CDD:290200 7/25 (28%)
C2H2 Zn finger 370..388 CDD:275368 5/20 (25%)
C2H2 Zn finger 396..416 CDD:275368 5/20 (25%)
zf-H2C2_2 408..432 CDD:290200 10/24 (42%)
C2H2 Zn finger 424..444 CDD:275368 8/20 (40%)
zf-H2C2_2 437..460 CDD:290200 10/23 (43%)
C2H2 Zn finger 452..472 CDD:275368 7/20 (35%)
zf-H2C2_2 464..488 CDD:290200 12/26 (46%)
C2H2 Zn finger 480..500 CDD:275368 7/23 (30%)
zf-H2C2_2 493..517 CDD:290200 11/25 (44%)
C2H2 Zn finger 508..528 CDD:275368 5/20 (25%)
C2H2 Zn finger 536..556 CDD:275368 2/5 (40%)
zf-H2C2_2 549..573 CDD:290200
C2H2 Zn finger 564..584 CDD:275368
zf-H2C2_2 576..601 CDD:290200
C2H2 Zn finger 592..612 CDD:275368
zf-H2C2_2 604..629 CDD:290200
C2H2 Zn finger 620..640 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.