DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and Zfp51

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001295252.1 Gene:Zfp51 MGIID:99198 Length:781 Species:Mus musculus

Alignment Length:430 Identity:135/431 (31%)
Similarity:200/431 (46%) Gaps:66/431 (15%)


  Fly    55 CVDEEEDD---GGEQDSKD--DDY-------VQPQLKKSARKGEPVKRKHHVCSQCSKEFGGKTD 107
            |.|..:|.   ..:|..::  |||       :||...        :|.|.|.|.:|.|.|...:.
Mouse   172 CSDISQDQRLYNAKQHRQEVYDDYFSSAYSLMQPTAY--------IKEKPHQCGKCGKCFNTSSS 228

  Fly   108 LQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLH 172
            |..|..||:.|:|:||..|.||:.|..:||.| ...|...|.:.|.:|.|||.....|:.|.:||
Mouse   229 LTVHHRIHTKEKPYKCSVCDKSFTQCTHLKIH-QRRHTGEKPYKCKECEKSFVQLSALKSHQKLH 292

  Fly   173 SGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHR 237
            :|||||.|..|||.||.....:.|...|  ||.:..:|.:|...|...::||.|...|.....::
Mouse   293 TGEKPYKCKECDKSFAHYPNFRTHQKIH--TSEEHCSCPECGREFHQLSHLRKHYRLHTGEKPYK 355

  Fly   238 CSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYF 302
            |:.|:..|.:..:||.| .:.|.....:||:.|.|.......|..|.:.||..|.:.||:|:..|
Mouse   356 CNECDRSFTHYASLRWH-QKTHTPEIHYECKECGKSFIELSHLKRHYRIHTGEKPYKCEICDKSF 419

  Fly   303 TQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLC------------- 354
            |..:....|.::||||:||:||.|.::|.|||.|:.|...||||:|:||:.|             
Mouse   420 TTTTTLKTHQKIHTGEKPYKCRECDKSFIHSSHLRRHQNVHTGERPYRCKECDKSFHESATLREH 484

  Fly   355 -------------EDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSH-VEHCAKC 405
                         |.:.:|:|.|:|:||..::|..::||.|:.|...|.....|:.| ..|..|.
Mouse   485 EKSHTGEKTYKCRECDKSFTQRAYLRNHHNRVHTGERPYECKECGKSFTTCSTLRIHQTIHTGKK 549

  Fly   406 P---VDGDKPSGNQSEDAQILSVLRFNMAVVLKKISSAQK 442
            |   ::..|...|.       |.||.:     :|:.|.:|
Mouse   550 PYKCIECGKSFTNN-------SYLRTH-----QKVHSGEK 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 58/159 (36%)
C2H2 Zn finger 95..115 CDD:275368 7/20 (35%)
zf-H2C2_2 107..132 CDD:290200 11/25 (44%)
C2H2 Zn finger 123..144 CDD:275368 8/21 (38%)
C2H2 Zn finger 152..172 CDD:275368 8/20 (40%)
zf-H2C2_2 165..189 CDD:290200 15/24 (63%)
C2H2 Zn finger 180..200 CDD:275368 7/20 (35%)
COG5048 <192..369 CDD:227381 62/203 (31%)
C2H2 Zn finger 210..230 CDD:275370 6/20 (30%)
C2H2 Zn finger 238..260 CDD:275371 7/22 (32%)
C2H2 Zn finger 267..287 CDD:275368 5/20 (25%)
C2H2 Zn finger 295..315 CDD:275368 6/20 (30%)
zf-H2C2_2 309..332 CDD:290200 11/23 (48%)
C2H2 Zn finger 323..343 CDD:275368 9/20 (45%)
C2H2 Zn finger 351..374 CDD:275368 9/49 (18%)
C2H2 Zn finger 382..399 CDD:275368 5/18 (28%)
Zfp51NP_001295252.1 KRAB 43..>83 CDD:214630
KRAB 43..82 CDD:279668
COG5048 196..616 CDD:227381 128/407 (31%)
C2H2 Zn finger 216..236 CDD:275368 7/20 (35%)
zf-H2C2_2 228..253 CDD:290200 11/25 (44%)
C2H2 Zn finger 244..264 CDD:275368 8/21 (38%)
zf-H2C2_2 256..281 CDD:290200 10/26 (38%)
C2H2 Zn finger 272..292 CDD:275368 8/20 (40%)
zf-H2C2_2 284..309 CDD:290200 15/25 (60%)
C2H2 Zn finger 300..320 CDD:275368 7/20 (35%)
zf-H2C2_2 340..365 CDD:290200 7/25 (28%)
C2H2 Zn finger 356..376 CDD:275368 6/21 (29%)
C2H2 Zn finger 384..404 CDD:275368 5/20 (25%)
zf-H2C2_2 396..419 CDD:290200 8/23 (35%)
C2H2 Zn finger 412..432 CDD:275368 6/20 (30%)
zf-H2C2_2 425..447 CDD:290200 10/22 (45%)
C2H2 Zn finger 440..460 CDD:275368 9/20 (45%)
zf-H2C2_2 452..476 CDD:290200 10/24 (42%)
COG5048 464..>774 CDD:227381 30/127 (24%)
C2H2 Zn finger 468..488 CDD:275368 2/20 (10%)
C2H2 Zn finger 496..517 CDD:275368 7/21 (33%)
C2H2 Zn finger 525..545 CDD:275368 5/20 (25%)
C2H2 Zn finger 553..573 CDD:275368 6/32 (19%)
zf-H2C2_2 565..590 CDD:290200 5/19 (26%)
C2H2 Zn finger 581..601 CDD:275368
zf-H2C2_2 594..618 CDD:290200
C2H2 Zn finger 609..629 CDD:275368
zf-H2C2_2 621..646 CDD:290200
C2H2 Zn finger 637..657 CDD:275368
zf-H2C2_2 649..674 CDD:290200
C2H2 Zn finger 665..685 CDD:275368
zf-H2C2_2 677..702 CDD:290200
C2H2 Zn finger 693..713 CDD:275368
zf-H2C2_2 705..730 CDD:290200
C2H2 Zn finger 721..741 CDD:275368
C2H2 Zn finger 749..769 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.