DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and Zscan2

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_033579.1 Gene:Zscan2 MGIID:99176 Length:614 Species:Mus musculus

Alignment Length:465 Identity:142/466 (30%)
Similarity:206/466 (44%) Gaps:70/466 (15%)


  Fly     2 VRSRRSVSKEDAVSLLTD-------SGISLSSPPAARES--------SPGPTLAIKRRKSSLASL 51
            ::..|..|.|:||:|:.|       |...:.|......:        |.|..|.|...:....|.
Mouse   109 LQEHRPESSEEAVALVEDLTQTFRHSDFEIQSENGENSNEDMFEGVESHGMFLNISGGEGGQQSD 173

  Fly    52 RDACVDEEEDDGGEQ------DSK---------------------DDDYVQPQLKKS-ARKGEPV 88
            .|:..:.:...||.|      |.:                     :..|..||..|: :||...:
Mouse   174 GDSDFERDCGSGGAQGHAPGEDPRVVPSEGREVGQLIGLQGTYLGEKPYECPQCGKTFSRKSHLI 238

  Fly    89 K-------RKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEH 146
            .       .|::.|.:|.|.|...::..||...|:.|:|:||:|||||:.::.||..| ...|..
Mouse   239 THERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCRDCGKSFSRSANLITH-QRIHTG 302

  Fly   147 RKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCT 211
            .|.|.|::|.|||:....|..|.|.|:|||||.|..|.|.|.....|..|...|  |..:.:.|.
Mouse   303 EKPFQCAECGKSFSRSPNLIAHQRTHTGEKPYSCPECGKSFGNRSSLNTHQGIH--TGEKPYACK 365

  Fly   212 KCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEP 276
            :|..|||.|:||..|...|.....::|:.|..:|:...||..| .:.|.....::|..|.|....
Mouse   366 ECGESFSYNSNLIRHQRIHTGEKPYKCTECGQKFSQSSALITH-RRTHTGEKPYQCGECGKNFSR 429

  Fly   277 DEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIR 341
            ..:||||.:.|...|.:.|.:|...|:|.|....|...||||:||:|..|.::|:.||.|..|.|
Mouse   430 SSNLATHRRTHLVEKPYKCGLCGKSFSQSSSLIAHQGTHTGEKPYECLTCGESFSWSSNLIKHQR 494

  Fly   342 KHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFK----IKVELQSHVEHC 402
            .||||||:||..|..  .|||.:.|..| ::.|..:|||.|..|...|.    :.:..::|:   
Mouse   495 THTGEKPYRCGDCGK--GFSQRSQLVVH-QRTHTGEKPYKCLMCGKSFSRGSILVMHQRAHL--- 553

  Fly   403 AKCPVDGDKP 412
                  ||||
Mouse   554 ------GDKP 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 58/166 (35%)
C2H2 Zn finger 95..115 CDD:275368 6/20 (30%)
zf-H2C2_2 107..132 CDD:290200 12/25 (48%)
C2H2 Zn finger 123..144 CDD:275368 9/21 (43%)
C2H2 Zn finger 152..172 CDD:275368 8/20 (40%)
zf-H2C2_2 165..189 CDD:290200 13/24 (54%)
C2H2 Zn finger 180..200 CDD:275368 6/20 (30%)
COG5048 <192..369 CDD:227381 63/177 (36%)
C2H2 Zn finger 210..230 CDD:275370 9/20 (45%)
C2H2 Zn finger 238..260 CDD:275371 7/22 (32%)
C2H2 Zn finger 267..287 CDD:275368 7/20 (35%)
C2H2 Zn finger 295..315 CDD:275368 6/20 (30%)
zf-H2C2_2 309..332 CDD:290200 10/23 (43%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
C2H2 Zn finger 351..374 CDD:275368 7/23 (30%)
C2H2 Zn finger 382..399 CDD:275368 4/21 (19%)
Zscan2NP_033579.1 SCAN 69..132 CDD:280241 7/23 (30%)
COG5048 220..600 CDD:227381 123/355 (35%)
zf-C2H2 222..244 CDD:278523 6/22 (27%)
C2H2 Zn finger 224..244 CDD:275368 5/20 (25%)
zf-H2C2_2 236..260 CDD:290200 5/24 (21%)
C2H2 Zn finger 252..272 CDD:275368 6/20 (30%)
zf-H2C2_2 264..289 CDD:290200 12/25 (48%)
C2H2 Zn finger 280..300 CDD:275368 9/21 (43%)
zf-H2C2_2 292..317 CDD:290200 11/26 (42%)
C2H2 Zn finger 308..328 CDD:275368 8/20 (40%)
zf-H2C2_2 320..343 CDD:290200 12/23 (52%)
C2H2 Zn finger 336..356 CDD:275368 6/20 (30%)
zf-H2C2_2 348..373 CDD:290200 9/27 (33%)
C2H2 Zn finger 364..384 CDD:275368 9/20 (45%)
zf-H2C2_2 376..401 CDD:290200 7/25 (28%)
C2H2 Zn finger 392..412 CDD:275368 6/21 (29%)
zf-H2C2_2 404..429 CDD:290200 7/26 (27%)
C2H2 Zn finger 420..440 CDD:275368 7/20 (35%)
zf-H2C2_2 432..457 CDD:290200 9/25 (36%)
C2H2 Zn finger 448..468 CDD:275368 6/20 (30%)
zf-H2C2_2 460..484 CDD:290200 10/24 (42%)
C2H2 Zn finger 476..496 CDD:275368 8/20 (40%)
zf-H2C2_2 488..513 CDD:290200 14/27 (52%)
C2H2 Zn finger 504..524 CDD:275368 7/23 (30%)
zf-H2C2_2 517..541 CDD:290200 9/25 (36%)
C2H2 Zn finger 532..552 CDD:275368 3/20 (15%)
zf-H2C2_2 545..568 CDD:290200 5/23 (22%)
C2H2 Zn finger 560..580 CDD:275368
zf-H2C2_2 573..597 CDD:290200
C2H2 Zn finger 588..608 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.