DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and Zfp105

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_033570.2 Gene:Zfp105 MGIID:1277119 Length:524 Species:Mus musculus

Alignment Length:364 Identity:119/365 (33%)
Similarity:174/365 (48%) Gaps:14/365 (4%)


  Fly    39 LAIKRRKSSL--ASLRDACVDEEEDDGGEQDSKDDDYVQPQLKKSARKGEPVK--RKHHVCSQCS 99
            |.||..|..|  |:::|..:.|...|..|.......|   .|:.:..|.:.::  :|...||:|.
Mouse   164 LRIKEEKGDLGEATVKDCPLSESFRDEEESKKSRGKY---SLRSTPGKNQKIQPGQKPFTCSECG 225

  Fly   100 KEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKER 164
            |.|....:|..|..||:.|:|.:|.:|||::.|:.||..| ...|..:|.:||.:|.|:|.....
Mouse   226 KGFSQSANLVVHQRIHTGEKPFECHECGKAFIQSANLVVH-QRIHTGQKPYVCGKCGKAFTQSSN 289

  Fly   165 LRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMER 229
            |.:|.::||.||.:.|..|:|.|:...||.:|...|  .:.:.:.|.:|..:|:.::||.||...
Mouse   290 LTVHQKIHSLEKTFKCSECEKAFSYSSQLARHQKVH--ITEKCYECNECGKTFTRSSNLIVHQRI 352

  Fly   230 HEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHV 294
            |.......||.|...|.....|..| .:.|.....::|:.|.|.......|..|.:.|||.|.:.
Mouse   353 HTGEKPFACSDCGKAFTQSANLIVH-QRSHTGEKPYKCKDCEKAFSCFSHLIVHQRIHTAEKPYD 416

  Fly   295 CEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVA 359
            |..|...|:|.|...||.|:|:|:.||.|..|.:.|..||.|.:|.|.|.||||:.|..|..  |
Mouse   417 CSECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPYSCNECGK--A 479

  Fly   360 FSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSH 398
            |.|.:.|..| ::.|..:|||.|..|...|.....|..|
Mouse   480 FRQRSSLTVH-QRTHTGEKPYECAKCGAAFISNSHLMRH 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 53/161 (33%)
C2H2 Zn finger 95..115 CDD:275368 8/20 (40%)
zf-H2C2_2 107..132 CDD:290200 10/25 (40%)
C2H2 Zn finger 123..144 CDD:275368 8/21 (38%)
C2H2 Zn finger 152..172 CDD:275368 6/20 (30%)
zf-H2C2_2 165..189 CDD:290200 10/24 (42%)
C2H2 Zn finger 180..200 CDD:275368 7/20 (35%)
COG5048 <192..369 CDD:227381 59/177 (33%)
C2H2 Zn finger 210..230 CDD:275370 7/20 (35%)
C2H2 Zn finger 238..260 CDD:275371 7/22 (32%)
C2H2 Zn finger 267..287 CDD:275368 5/20 (25%)
C2H2 Zn finger 295..315 CDD:275368 8/20 (40%)
zf-H2C2_2 309..332 CDD:290200 10/23 (43%)
C2H2 Zn finger 323..343 CDD:275368 8/20 (40%)
C2H2 Zn finger 351..374 CDD:275368 7/23 (30%)
C2H2 Zn finger 382..399 CDD:275368 5/18 (28%)
Zfp105NP_033570.2 COG5048 <209..366 CDD:227381 52/160 (33%)
zf-C2H2 219..241 CDD:278523 8/22 (36%)
C2H2 Zn finger 221..241 CDD:275368 8/20 (40%)
zf-H2C2_2 233..258 CDD:290200 10/25 (40%)
C2H2 Zn finger 249..269 CDD:275368 8/21 (38%)
zf-H2C2_2 261..286 CDD:290200 10/26 (38%)
C2H2 Zn finger 277..297 CDD:275368 6/20 (30%)
COG5048 <286..486 CDD:227381 68/205 (33%)
zf-H2C2_2 289..314 CDD:290200 10/25 (40%)
C2H2 Zn finger 305..325 CDD:275368 7/20 (35%)
zf-C2H2 331..353 CDD:278523 7/22 (32%)
C2H2 Zn finger 333..353 CDD:275368 7/20 (35%)
zf-H2C2_2 345..370 CDD:290200 9/25 (36%)
C2H2 Zn finger 361..381 CDD:275368 6/21 (29%)
zf-H2C2_2 373..398 CDD:290200 6/26 (23%)
C2H2 Zn finger 389..409 CDD:275368 5/20 (25%)
zf-H2C2_2 401..426 CDD:290200 9/25 (36%)
C2H2 Zn finger 417..437 CDD:275368 8/20 (40%)
C2H2 Zn finger 445..465 CDD:275368 8/20 (40%)
zf-H2C2_2 457..482 CDD:290200 12/27 (44%)
zf-C2H2 471..493 CDD:278523 7/25 (28%)
C2H2 Zn finger 473..493 CDD:275368 7/23 (30%)
zf-H2C2_2 485..508 CDD:290200 8/24 (33%)
C2H2 Zn finger 501..521 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.