DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and ZNF431

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_011526052.1 Gene:ZNF431 HGNCID:20809 Length:593 Species:Homo sapiens

Alignment Length:339 Identity:114/340 (34%)
Similarity:161/340 (47%) Gaps:33/340 (10%)


  Fly    78 LKKSARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQ---------- 132
            |..|..|...::...:.|.:|.|.|...:.|.||..||:.|:|.||::|||:::|          
Human   234 LHLSQHKRIHIRENSYQCEECGKAFKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKII 298

  Fly   133 --------------AVNLKNHITT---AHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPC 180
                          |.|..:|:||   .|...|.:.|.:|.|:|.....|..|..:|:|||||.|
Human   299 HTGEKPYRCEECGKAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKC 363

  Fly   181 DLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQF 245
            :.|||.|.|...|.:|.:.|  |..:.:.|.:|...|:.::.|..|...|.....::|.:|...|
Human   364 EECDKAFNRFSYLTKHKIIH--TGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAF 426

  Fly   246 ANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNV 310
            .....|..| ...|.....::||.|.|.......|..|...||..|.:.||.|...|:|.|....
Human   427 NESSNLTTH-KMIHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTT 490

  Fly   311 HMRMHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHK 375
            |.|:||||:||:|..|.:.|..||.|..|...|||||.::|:.|..  ||:|.:.|..| :|||.
Human   491 HKRIHTGEKPYKCEECGKAFNRSSNLTKHKIIHTGEKSYKCEECGK--AFNQSSTLTKH-RKIHT 552

  Fly   376 QQKPYMCEGCHDFF 389
            :||||.||.|.:.|
Human   553 RQKPYNCEECDNTF 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 55/186 (30%)
C2H2 Zn finger 95..115 CDD:275368 8/20 (40%)
zf-H2C2_2 107..132 CDD:290200 12/25 (48%)
C2H2 Zn finger 123..144 CDD:275368 10/48 (21%)
C2H2 Zn finger 152..172 CDD:275368 6/20 (30%)
zf-H2C2_2 165..189 CDD:290200 13/24 (54%)
C2H2 Zn finger 180..200 CDD:275368 8/20 (40%)
COG5048 <192..369 CDD:227381 57/177 (32%)
C2H2 Zn finger 210..230 CDD:275370 5/20 (25%)
C2H2 Zn finger 238..260 CDD:275371 6/22 (27%)
C2H2 Zn finger 267..287 CDD:275368 6/20 (30%)
C2H2 Zn finger 295..315 CDD:275368 8/20 (40%)
zf-H2C2_2 309..332 CDD:290200 11/23 (48%)
C2H2 Zn finger 323..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 351..374 CDD:275368 9/23 (39%)
C2H2 Zn finger 382..399 CDD:275368 4/9 (44%)
ZNF431XP_011526052.1 KRAB 51..112 CDD:214630
KRAB 51..90 CDD:279668
zf-H2C2_2 209..230 CDD:290200
COG5048 218..570 CDD:227381 114/340 (34%)
C2H2 Zn finger 223..243 CDD:275368 3/9 (33%)
C2H2 Zn finger 251..271 CDD:275368 8/20 (40%)
zf-H2C2_2 264..288 CDD:290200 12/24 (50%)
C2H2 Zn finger 279..299 CDD:275368 5/20 (25%)
zf-H2C2_2 292..316 CDD:290200 2/24 (8%)
C2H2 Zn finger 307..327 CDD:275368 5/20 (25%)
zf-H2C2_2 319..344 CDD:290200 9/25 (36%)
C2H2 Zn finger 335..355 CDD:275368 6/20 (30%)
C2H2 Zn finger 363..383 CDD:275368 8/20 (40%)
zf-H2C2_2 375..399 CDD:290200 7/26 (27%)
C2H2 Zn finger 391..411 CDD:275368 5/20 (25%)
zf-H2C2_2 404..427 CDD:290200 6/23 (26%)
C2H2 Zn finger 419..439 CDD:275368 5/21 (24%)
zf-H2C2_2 431..456 CDD:290200 7/26 (27%)
C2H2 Zn finger 447..467 CDD:275368 6/20 (30%)
zf-H2C2_2 460..484 CDD:290200 9/24 (38%)
C2H2 Zn finger 475..495 CDD:275368 8/20 (40%)
zf-H2C2_2 488..512 CDD:290200 11/24 (46%)
C2H2 Zn finger 503..523 CDD:275368 7/20 (35%)
zf-H2C2_2 515..540 CDD:290200 11/27 (41%)
C2H2 Zn finger 531..551 CDD:275368 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.