DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and ZNF257

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_258429.2 Gene:ZNF257 HGNCID:13498 Length:563 Species:Homo sapiens

Alignment Length:425 Identity:130/426 (31%)
Similarity:175/426 (41%) Gaps:70/426 (16%)


  Fly    71 DDYVQPQLKKS---ARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQ 132
            |.||:...|.|   ..|....::|...|.:|.|.|...:.|.||..||..|..|||::|||::.|
Human   148 DKYVKVFYKFSNSDRHKIRHTEKKTCKCKECGKSFCMLSQLTRHKRIHIRENSHKCEECGKAFNQ 212

  Fly   133 AVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHM 197
            :..|..|..| |...|.:.|.:|.|:|.....|..|..:|:.||||.|:.|.|.|.|...:.||.
Human   213 SSALTRHKMT-HTGEKPYKCEECGKAFNRSSHLTQHKVIHTREKPYKCEECGKAFNRSSHITQHK 276

  Fly   198 VSHHKTSIQQFNCTKCSASF---STNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEH 259
            ..|::.  :.|...:|..:|   |....|..|...|.....::|..|...|....||..| ...|
Human   277 RIHNRE--KPFKYDECCKAFKWSSALTTLTQHKRIHTGEKPYKCEECGKAFNQSSALTRH-KMIH 338

  Fly   260 HKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMR----------- 313
            .....|:||.|.|.......|..|...||..|.:.||.|...|.:.|....|.|           
Human   339 TGEKPFQCEECGKAFNRSSHLTQHKIIHTKEKPYKCEECGKAFNRSSHLTKHKRIHTREKAYKCD 403

  Fly   314 --------------------MHTGERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEV 358
                                :||||:||:|..|.:.|..||.|..|...||||||::|:.|..  
Human   404 EYCKAFNWSSALTTLTQHKIIHTGEKPYKCEECGKAFNRSSYLIRHKIIHTGEKPYKCEECGK-- 466

  Fly   359 AFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVELQSH-VEH-------CAKCPVDGDKPSGN 415
            ||:|.:||..| |.||..:|||.||.|...|.....|..| :.|       |.:|    .||.. 
Human   467 AFNQSSHLTQH-KIIHTGEKPYKCEECGKAFNRSSHLSQHKIIHTGEKPYKCEEC----GKPFN- 525

  Fly   416 QSEDAQILSVLRFNMAVVLKKISSAQKLRQLGYEK 450
                       ||:...|.|:|.:.:...:  ||:
Human   526 -----------RFSYLTVHKRIHAGENPNK--YEE 547

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 52/162 (32%)
C2H2 Zn finger 95..115 CDD:275368 8/20 (40%)
zf-H2C2_2 107..132 CDD:290200 12/25 (48%)
C2H2 Zn finger 123..144 CDD:275368 8/21 (38%)
C2H2 Zn finger 152..172 CDD:275368 6/20 (30%)
zf-H2C2_2 165..189 CDD:290200 11/24 (46%)
C2H2 Zn finger 180..200 CDD:275368 7/20 (35%)
COG5048 <192..369 CDD:227381 60/211 (28%)
C2H2 Zn finger 210..230 CDD:275370 5/23 (22%)
C2H2 Zn finger 238..260 CDD:275371 7/22 (32%)
C2H2 Zn finger 267..287 CDD:275368 6/20 (30%)
C2H2 Zn finger 295..315 CDD:275368 7/51 (14%)
zf-H2C2_2 309..332 CDD:290200 11/54 (20%)
C2H2 Zn finger 323..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 351..374 CDD:275368 10/23 (43%)
C2H2 Zn finger 382..399 CDD:275368 6/18 (33%)
ZNF257NP_258429.2 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
COG5048 <157..474 CDD:227381 100/323 (31%)
C2H2 Zn finger 175..195 CDD:275368 8/20 (40%)
C2H2 Zn finger 203..223 CDD:275368 8/21 (38%)
zf-H2C2_2 215..240 CDD:290200 9/26 (35%)
C2H2 Zn finger 231..251 CDD:275368 6/20 (30%)
zf-H2C2_2 243..268 CDD:290200 11/25 (44%)
C2H2 Zn finger 259..279 CDD:275368 7/20 (35%)
C2H2 Zn finger 288..310 CDD:275368 5/22 (23%)
zf-H2C2_2 303..327 CDD:290200 6/24 (25%)
C2H2 Zn finger 318..338 CDD:275368 6/21 (29%)
zf-H2C2_2 330..355 CDD:290200 9/26 (35%)
C2H2 Zn finger 346..366 CDD:275368 6/20 (30%)
zf-H2C2_2 358..383 CDD:290200 9/25 (36%)
C2H2 Zn finger 374..394 CDD:275368 7/20 (35%)
zf-H2C2_2 418..442 CDD:290200 9/24 (38%)
C2H2 Zn finger 433..453 CDD:275368 7/20 (35%)
zf-H2C2_2 445..470 CDD:290200 12/27 (44%)
C2H2 Zn finger 461..481 CDD:275368 10/23 (43%)
zf-H2C2_2 473..498 CDD:290200 13/26 (50%)
C2H2 Zn finger 489..509 CDD:275368 6/20 (30%)
zf-H2C2_2 501..526 CDD:290200 7/41 (17%)
C2H2 Zn finger 517..537 CDD:275368 9/36 (25%)
C2H2 Zn finger 545..561 CDD:275368 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.