DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11247 and Gm14139

Sequence 1:NP_001097659.1 Gene:CG11247 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001139335.1 Gene:Gm14139 MGIID:3836251 Length:495 Species:Mus musculus

Alignment Length:388 Identity:120/389 (31%)
Similarity:170/389 (44%) Gaps:70/389 (18%)


  Fly    79 KKSARKGEPVKRKH-HV------CSQCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNL 136
            |..|||...::.|. |.      |.||.|.....|.|.:|..:|:.|:|::||.|.|:....:.|
Mouse   110 KSFARKSHLLRHKRTHTGEKPFQCYQCGKTLARNTHLLQHKKVHTGEKPYECKHCDKASVCHIGL 174

  Fly   137 KNHITT---------------------------AHEHRKQFVCSQCPKSFALKERLRLHMRLHSG 174
            ..|..|                           .|...|.|.|:||.||||.|..|..|.|:|:|
Mouse   175 LYHKRTHAGQRPYEWNECGKSIVYHSCIKQCKRRHTGEKPFECNQCGKSFARKSNLLRHKRIHTG 239

  Fly   175 EKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCS 239
            ||||.||.|.|.||....|:.|...|  |....:.|.:|..:|:..:.||.|...|.......|:
Mouse   240 EKPYKCDQCGKDFASPSSLKCHKRVH--TGENPYECKQCGKAFARLSILRTHKRTHTGEKPFECN 302

  Fly   240 ICENQFANELAL----RAHINQEHHKLTQ-----------------------FECEICHKMIEPD 277
            .|...||.:..|    |.|..::.:|..|                       :||:.|.|.....
Mouse   303 ECGKSFARKSHLLRHKRIHTGEKPYKCDQCGKDLACPNSLQYHKRVHTGEKSYECKQCGKAFAFS 367

  Fly   278 EDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRK 342
            ..|..|.:.||..|.:.|..|...|:..|.:..|.:.|||||||:|..|.::|.|.|..::|.|.
Mouse   368 TSLRIHKRTHTGEKPYECNQCGKAFSSPSGFLYHKQTHTGERPYECNECGKSFIHRSNFQMHKRT 432

  Fly   343 HTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFF----KIKVELQSHVEH 401
            |||||||.|..|..  :|:|..:|..| |::|..:|||.|:.|...|    .::|.:::|.::
Mouse   433 HTGEKPFECDQCGK--SFAQNTYLLQH-KRVHTGEKPYECKHCGKAFAYSNNLRVHIRTHTKY 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 60/193 (31%)
C2H2 Zn finger 95..115 CDD:275368 7/20 (35%)
zf-H2C2_2 107..132 CDD:290200 9/25 (36%)
C2H2 Zn finger 123..144 CDD:275368 7/48 (15%)
C2H2 Zn finger 152..172 CDD:275368 11/20 (55%)
zf-H2C2_2 165..189 CDD:290200 15/24 (63%)
C2H2 Zn finger 180..200 CDD:275368 8/20 (40%)
COG5048 <192..369 CDD:227381 60/204 (29%)
C2H2 Zn finger 210..230 CDD:275370 6/20 (30%)
C2H2 Zn finger 238..260 CDD:275371 7/26 (27%)
C2H2 Zn finger 267..287 CDD:275368 5/20 (25%)
C2H2 Zn finger 295..315 CDD:275368 5/20 (25%)
zf-H2C2_2 309..332 CDD:290200 11/23 (48%)
C2H2 Zn finger 323..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 351..374 CDD:275368 7/23 (30%)
C2H2 Zn finger 382..399 CDD:275368 5/21 (24%)
Gm14139NP_001139335.1 KRAB 4..>45 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 79..97 CDD:275368
COG5048 99..453 CDD:227381 108/347 (31%)
C2H2 Zn finger 105..125 CDD:275368 5/15 (33%)
zf-H2C2_2 117..142 CDD:290200 6/25 (24%)
C2H2 Zn finger 133..153 CDD:275368 7/20 (35%)
C2H2 Zn finger 161..181 CDD:275368 7/20 (35%)
C2H2 Zn finger 190..209 CDD:275368 0/19 (0%)
C2H2 Zn finger 217..237 CDD:275368 11/20 (55%)
zf-H2C2_2 229..254 CDD:290200 15/25 (60%)
C2H2 Zn finger 245..265 CDD:275368 8/20 (40%)
zf-H2C2_2 257..282 CDD:290200 7/27 (26%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 286..310 CDD:290200 8/24 (33%)
C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
zf-H2C2_2 313..334 CDD:290200 5/21 (24%)
C2H2 Zn finger 329..349 CDD:275368 1/20 (5%)
zf-H2C2_2 341..365 CDD:290200 4/24 (17%)
C2H2 Zn finger 357..377 CDD:275368 5/20 (25%)
zf-H2C2_2 369..394 CDD:290200 8/25 (32%)
C2H2 Zn finger 385..405 CDD:275368 5/20 (25%)
C2H2 Zn finger 413..433 CDD:275368 7/20 (35%)
zf-H2C2_2 425..450 CDD:290200 12/27 (44%)
C2H2 Zn finger 441..461 CDD:275368 7/23 (30%)
zf-H2C2_2 453..478 CDD:290200 10/26 (38%)
C2H2 Zn finger 469..489 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.