DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and rsph10b

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001070227.1 Gene:rsph10b ZFINID:ZDB-GENE-060929-300 Length:731 Species:Danio rerio

Alignment Length:821 Identity:158/822 (19%)
Similarity:284/822 (35%) Gaps:280/822 (34%)


  Fly   676 GDSLR---LTTPE----KSFLVSTRSQEMRKVWLD-----QLQSSIIASL---------GKPLGS 719
            ||:::   .:|||    |:.:.|:.|..:.:..::     .|.||.:.|.         .:|:|.
Zfish     4 GDNMKSSNKSTPEPTLSKTLVESSTSSLLSESVVEPEDGQDLSSSAVCSASTVSLPPNENQPIGE 68

  Fly   720 -----PVPSYRSTGYEFSREHPKFSRVKACGTWRKGVLHGNCYLEYPDGSVYCGELQHGIIEGFG 779
                 .||...|...|      ::...| ||.    :.||.....:..|.||.|...||::.|:|
Zfish    69 HDRCRTVPVLHSIIVE------RYEGEK-CGE----MFHGEGVAYFQGGHVYKGSFSHGLMHGYG 122

  Fly   780 KMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGLFHGHG---------VMRNN 835
            :.:......|.|:||.....|||.|..     .....|||...:|:.||.|         |.|..
Zfish   123 EYIWSDGLKYQGDFKVNVPMGHGTYTW-----LNGSTYEGEVHQGIRHGVGMYKCVKTLTVYRGQ 182

  Fly   836 RYI------------------YVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNR 882
            .|:                  |.||:..|.|.|:|. ....||:.|.|.:.:|.|.|.|   |.|
Zfish   183 WYLGKRQGQGEMFYNQEATSWYKGEWVNNCREGWGK-RCYPSGNVYEGQWRNNVRHGEG---TMR 243

  Fly   883 GDYFEGSFSGDDLTGSGVAVFENDYY--------------YEGELTLLGPNGRGEYYMPSGDACG 933
            ....:..:||..:.|.......:.::              |.|:......:|:|::..       
Zfish   244 WIDLDQQYSGQWINGIQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLY------- 301

  Fly   934 GSGAMGTGEFDDTCELIGNKMFGQLSGTWDTVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKWRS 998
            .|||:..|::.      .:|..||                            ||.:.::.|.:..
Zfish   302 ASGALYCGQWK------YDKKHGQ----------------------------GRYIFENGRVYEG 332

  Fly   999 LFNNFESDLANCTASTSSSGGNQSAGTLRKSSKPTLSTAQIWNCIAVYMSKQRAREGTKPGNYFN 1063
            .|:.                                      :|:|.:.:......|        
Zfish   333 EFSK--------------------------------------DCMAEFPAFTPGLSG-------- 351

  Fly  1064 NILLSLPLPQKTSSPLAKARTTTSA-------LSKLQT------EAASALDFLGFPPRRIQSQEA 1115
               ::.|.|.:..|....::::::|       :..:||      ||....:|.       |.:.|
Zfish   352 ---ITTPFPDENDSSKGASQSSSNASPLGSDMVLNIQTLLNRVSEAHREQEFK-------QVEFA 406

  Fly  1116 LNSKPGGLQRADSLI-SMGHNTSRDLDNSSLASFQLDQSLMNSTVNGDESSTFNESFSKLS-HNN 1178
            :....|.|:...|.. |:||..|.| ....|...|..:.|::..|: ....|..:.:|.:: |:.
Zfish   407 VLRHMGLLREIYSFYSSLGHEQSLD-KIFPLTHLQFSRFLLDCRVH-QHGVTLAQIYSLINVHSP 469

  Fly  1179 NNS------------ISKHMNNIDCSITSTTSTTSAVLDQVPSFGMALVLTEQDV----TSIRLY 1227
            ..:            |:.|:.:.|  |.|:.:..:|...:         |.:|::    .|::.:
Zfish   470 FTAILPRECISYIIIIAYHICHKD--IESSNNILAACFSK---------LMKQNIIPNAKSVKGH 523

  Fly  1228 LEQAFKDRHHPLYVLNERIANCFHYSYGYWKVKPTPILAKQAMREWESISRRIYRFVRKMFPALP 1292
            |      ..||::.     |...:||...|::       .||:.|..|:      |..:.|..:.
Zfish   524 L------FCHPVHA-----AVAMNYSDKSWEI-------YQALCEAHSV------FTVRQFVLML 564

  Fly  1293 EELCQMEGS---REVISHITLLYPLVLSEGIYSTL-----FVLYANKYSRKDEMYRQNLNLAEKL 1349
            ::||..:..   .::|..:::..| .:.:|.||.|     |:          |.:...|..|| |
Zfish   565 KDLCLYDNELTVSKLIRTLSVDSP-AIHDGTYSNLDLEMSFL----------EFFEALLGCAE-L 617

  Fly  1350 KDQELVELMGHESFLHNVMLDPKFVESVQTL-KELQEKFSP 1389
            |.|::      :|: .....|....:.:.:| ||.:::.||
Zfish   618 KGQKI------QSY-DESQTDASLQDHISSLSKEKEQRQSP 651

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622 12/60 (20%)
VPS9 1373..1479 CDD:280383 5/19 (26%)
rsph10bNP_001070227.1 MORN 1 86..108 6/27 (22%)
MORN 2 109..131 6/22 (27%)
MORN 109..129 CDD:280628 6/20 (30%)
MORN 3 132..154 8/27 (30%)
MORN 4 155..177 7/22 (32%)
MORN 5 179..201 2/22 (9%)
COG4642 194..334 CDD:226989 34/185 (18%)
MORN 6 204..226 9/23 (39%)
MORN 225..246 CDD:197832 8/24 (33%)
MORN 7 227..249 8/25 (32%)
MORN 8 251..273 3/22 (14%)
MORN 9 284..306 7/29 (24%)
MORN 10 307..329 7/56 (13%)
MORN 307..327 CDD:280628 6/54 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.