DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and sergef

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_021329502.1 Gene:sergef ZFINID:ZDB-GENE-061220-11 Length:397 Species:Danio rerio

Alignment Length:338 Identity:79/339 (23%)
Similarity:120/339 (35%) Gaps:98/339 (29%)


  Fly    48 SNAGGELLLLTTDHALYSAKLQANREHMDLQLLRTDVVDMDFCSGSQELFVVLTNGSVQRQATGS 112
            |||.|:|        ..||:...:.|.:.|:.....|..:  .:|.:.......:|.|.:..||.
Zfish   123 SNAFGQL--------GGSAEKTHSAEPLLLKSFHEPVTSV--AAGLRHALASTASGCVYQWGTGL 177

  Fly   113 GRDVGHPHAWQTLGFDPLELHAEGVRIRRVCCSAQGVVFVGASGETYVMGSC--------GEVFK 169
            .     .||.:.|...|:..|...    :..|...|  |...:.:..:.||.        |:|| 
Zfish   178 S-----SHAKRMLNPQPVPSHLSS----KEPCLVPG--FAHVTTQKVIAGSAHCACLTVNGDVF- 230

  Fly   170 AEQQPRHMRLYEEGKELLDLAAGNEHFVMLVAPYNLADDALQLSVASAKEEPEDERASVKSISSG 234
                               |...|:|..::....     .|.|.||..:...:|||  |..:.||
Zfish   231 -------------------LWGSNKHGQLISGSL-----FLPLPVALDRSMLQDER--VSDVHSG 269

  Fly   235 HSERSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDS---------- 289
            .:         ||:.|..:   .::||:|.||.|.||..:|     .|..|..|.          
Zfish   270 WT---------HLVAQTES---GRVFTWGRSNYGQLGQTNH-----SMEKQSCDERLVRSPVEVK 317

  Fly   290 --MGVCSIAAGLEHTVARTLDGRLYHWGLNNHSQLG----EDVSSPMEITITENTAALPIEQNSA 348
              .|...|:.|.||.:| .:.||::.||.|.|...|    :|::.|..|....:..||.|     
Zfish   318 ALFGATQISCGSEHNLA-VVGGRVFSWGWNEHGMCGDGSLQDITQPQPIPALADAVALLI----- 376

  Fly   349 LEATCGDYHTLLL 361
               .||..|::.|
Zfish   377 ---GCGAGHSMAL 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 17/58 (29%)
RCC1_2 292..321 CDD:290274 11/29 (38%)
RCC1 308..361 CDD:278826 16/57 (28%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
sergefXP_021329502.1 RCC1 13..387 CDD:332518 79/339 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.