DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and si:ch211-146m13.3

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_693582.3 Gene:si:ch211-146m13.3 ZFINID:ZDB-GENE-110408-64 Length:887 Species:Danio rerio

Alignment Length:805 Identity:153/806 (19%)
Similarity:250/806 (31%) Gaps:271/806 (34%)


  Fly   759 EYPDGSVYCGELQHGIIEGFGKMVIPT-TGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFC 822
            ::.||..|||..:.|...|.|....|. .|.|.|.:..| |...|||..     |....|:|.:.
Zfish     8 DFDDGGSYCGGWEQGKAHGRGVCTGPQGQGEYAGAWSHG-FEVLGVYTW-----PSGNSYKGTWA 66

  Fly   823 EGLFHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFE 887
            :|..||.||....|:.|.||:....:..||.:|...||.:|.|.:::..:.|.||...:.|..::
Zfish    67 QGKRHGIGVESKGRWEYKGEWTQGFKGRYGKLESTSSGSRYEGTWSNGLQDGYGSETYSDGGTYQ 131

  Fly   888 GSFSGDDLTGSGVAVFENDYYYEGELTLLGP---------NGRGEYYMPSGDACGGSGAMGT--- 940
            |.:......|.||   .....|.....:..|         :...|......|..|.||..|:   
Zfish   132 GQWLSGLRHGYGV---RQSVPYGMAAIIFSPMCTSINSLRSDHSEGAPTPEDGSGVSGVSGSPVG 193

  Fly   941 ---------GEFDDTCELIGNKMFGQLSGTWDTVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKW 996
                     .|.|...:..|......|||           |.|.|...|  |||..|:       
Zfish   194 RSGFVLCAHSEADRHRKRKGRFRQSILSG-----------LKLRRSESK--SSLASQL------- 238

  Fly   997 RSLFNNFESDLANCTASTSSSGGNQSAGTLRKSSKPTLSTAQIWNCIAVYMSKQRARE------- 1054
             |..::|.|:....|.|:::|..|         |..:|..|:....:...:::..|.|       
Zfish   239 -SKQSSFCSEAGMSTVSSAASDIN---------SNVSLGEAEAGGSVDATVTETYAGEWRNDMRT 293

  Fly  1055 --------------------------------GTK-PGNYFNNILLSLP----LPQKTSSPLAKA 1082
                                            ||| .|.|..|:|:|..    :|.:||....|.
Zfish   294 GWGVSHRSDGLHFEGEWFGNKRHGYGCTTFPDGTKEEGKYKQNVLVSGKRKNLIPLRTSKIREKV 358

  Fly  1083 RTTTSALSK----LQTEAASALDFLGFPPRRIQSQEALNSKPGGLQRADSLISMGHNTSRDLDNS 1143
            .....|..|    .:.:|..||..:.....:.::.|      |..|||.....:....:::|.  
Zfish   359 DRALEAAEKAADIAKQKAEIALSRMSHARGKAEAAE------GVAQRALEECRLARAIAKELS-- 415

  Fly  1144 SLASF------------------QLDQSLMNSTVNGDE-------------------SSTFNESF 1171
              .||                  :.|..::::..:..|                   ||..:...
Zfish   416 --PSFHHYGNGLECQRPKHHDRKEKDHEVVSTGTDSPELCTPDTTPPVQTPDLSPVLSSPSSPPC 478

  Fly  1172 SKLSHNNNNSISKHMNNID-------------CSITST-TSTTSAVLDQVP---------SFGMA 1213
            |..:|.|.|:.....:.:|             ..|.|| ....|...:..|         |....
Zfish   479 SPPTHRNRNACFMRQSAVDEQGGAEIQVLVEGRGIDSTRAGANSWTAEMYPHRRGSKGESSRSTT 543

  Fly  1214 LVLTEQDVTSIRLYLEQAFKDRHHPLYVLNERIANCFHYSYGYWKVKPTPILAKQAMREWESISR 1278
            ..|.|::::.|..:....    |||             :..|....||...:|.:  :.|:    
Zfish   544 PSLLEEEISHINGHENST----HHP-------------WENGSSNHKPIEHMAPE--KVWD---- 585

  Fly  1279 RIYRFVRKMFPALPEELCQMEGSREVISHITLLYPLVLSEGIYSTLFVLYANKYSRKDEMYRQ-- 1341
                              ||..:::...|::|                   |:.:|:..:.|:  
Zfish   586 ------------------QMSSNQKPWKHVSL-------------------NQKTREHAISRERE 613

  Fly  1342 ------NLNLAE----KLKDQELVELMGHESFLHNVMLDPKFVESVQTLKELQE----------- 1385
                  |.|..:    |.|.|..: ...|:|..||.:.:.|..|...|..:.:|           
Zfish   614 REHKPSNHNSVDCESSKFKPQVHI-YSNHKSAGHNNLSNHKTNEHASTNHKPKEFISAHEKPHVS 677

  Fly  1386 -KFSPQDMLTVIQRSTQLLTEAYEH 1409
             .::||:.::...:.       :||
Zfish   678 YHYNPQEHVSSYHKQ-------HEH 695

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383 7/50 (14%)
si:ch211-146m13.3XP_693582.3 MORN 107..129 CDD:280628 6/22 (27%)
MORN 306..328 CDD:280628 2/22 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.