DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and rpgrb

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001299605.1 Gene:rpgrb ZFINID:ZDB-GENE-081015-2 Length:1413 Species:Danio rerio

Alignment Length:1210 Identity:214/1211 (18%)
Similarity:383/1211 (32%) Gaps:381/1211 (31%)


  Fly   163 SCGEVFKAEQQPRHMRLYEEGKELLDLAAGNEHFVMLVAPYNLADDALQLSVASAKEEPEDERAS 227
            |||:        .|..|..|..:|....:.|.             ..|.|...:...:|    ..
Zfish    42 SCGD--------EHTALVTENGKLFMFGSNNW-------------GQLGLGTKTTVNKP----TC 81

  Fly   228 VKSISSGHSERSVAANTRHLLHQGYALLHTQLFT-------FGASNNGLLGSGDHIRRANVMRLQ 285
            ||::.|...:.:....|           ||.:||       .|.:|.|.||.||...|.:...::
Zfish    82 VKALKSERVKLTACGRT-----------HTLVFTSRGNLYACGGNNEGQLGLGDCNDRTSFHLVE 135

  Fly   286 KLDSMG-VCSIAAGLEHTVARTLDGRLYHWGLNNHSQLG----EDVSSPMEITITENTAALPIEQ 345
            ..:..| :..:|||...:.|.|.|||||.||.|:..|:|    .:..:|.|:::.:.        
Zfish   136 FFNKQGPIKMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLGKESNALTPQEVSVGKR-------- 192

  Fly   346 NSALEATCGDYHTLLLNASGQIHSLQPAPPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGG 410
              ....:||.||:..:...|.:::.......:....:...|...:..|: ...|.::..:.|.||
Zfish   193 --VFWVSCGYYHSAFVTVDGALYTFGEKDSGKLGLSTEKLANHKVPQQV-TDIPDRVVQVACGGG 254

  Fly   411 YTL---QNQ------RQFQRQYHYYLSH----LQSQLQLLLKH--RQAVQTLEIWQRQSALEPLS 460
            :|:   :|:      .||.:     |.|    .:|:|..:::|  :..|:.....:..:||...:
Zfish   255 HTVALTENEVYSFGLGQFGQ-----LGHGTFIFESRLPRVVEHFRKGRVKHAACGENHTALITDN 314

  Fly   461 AL---------GPLLINWERI-------LC--LLVATLHSLE--GFYRADFVQPA-----DLLFI 500
            .|         |.|.:..|..       ||  .|...:||:.  |.:.....:|.     ||:. 
Zfish   315 GLLYTFGDGRHGKLGLGEENFTNQFKPTLCPRFLDYHVHSVTCGGCHMLVLAKPRTERPDDLIL- 378

  Fly   501 CHYKEYIDLFDGY-TKAYCDVF------------------------SVNGFGEAVVAITGLS-SP 539
                |..|:.:.| .|:|.::.                        |.:.||:....:..|| :.
Zfish   379 ----EEDDVTEDYLEKSYTELLGDTHSQTTLNRSLSARVRRRERERSPDQFGQMFRTLPALSGNQ 439

  Fly   540 LAELNEESYVTRLFQQPFSIYQLFVQFMELL---VRTQSEYGEHRVAWSEFARH----------- 590
            .|.|:..|.:     :|.|.....:....|.   :|.:|......|..||..:.           
Zfish   440 SASLSVPSQI-----RPSSKQLGKIPHNSLKTPGIRAKSFDDRSSVEDSESVKDLGETTDLLNLT 499

  Fly   591 SCISQELAVNTKDFWSSNDRNPRIVQFRGRH-------------RRVILTSALVPLKLVTSGISR 642
            ..:..:.:.||........:..::|:..|:.             |..:|:...:|.:|:     |
Zfish   500 HIMKMDPSDNTLTLSPMEKKKVKVVKEHGKEKGKPRDEPTPYSKRAELLSRKALPTELL-----R 559

  Fly   643 SSNSFILFSDFLCQVSGNSLYSYPLTTLWVWTEGDSLRLTTPEKS----------FLVSTR---- 693
            ||             ||:|:.            |||..|.||.||          .|::..    
Zfish   560 SS-------------SGSSVV------------GDSRGLGTPHKSPKRRGHDKENVLIALEGRKP 599

  Fly   694 ----------------------------SQEMRKVWLDQLQSSIIASLGKPLGSPVPSYRSTGYE 730
                                        |.:::|...::.|.:....:.:..|:..|:...||..
Zfish   600 GSKTGKGMDKSRAGSKSLKLKHTELMESSDKVKKQSTEKTQQNQEVEVQRSKGTSKPTQEGTGKA 664

  Fly   731 FSREH-----PKFSRV--KACGTWRKGVLHGNCYLEYPDGSVYCGELQHGIIEGFGKMVIPTTGL 788
            .:::|     .:...|  |..|...|.::            :....:...:.....|.|:|....
Zfish   665 KAKDHQLEVKSQLQNVAGKEKGVKSKPII------------IVEQHIDQDLTSKNSKEVLPKVQK 717

  Fly   789 YVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGL-FHGHGVMRNNRYIYVGEYQANARSGYG 852
            ..|:.|..............|...|.::......:.: ...|.....:......:.:|..|.   
Zfish   718 VKGDTKIAETENKSFVPQSKKSGSEKDLKSSKTTKEISTTSHPTSGKDTSAKTKKSRAEQRQ--- 779

  Fly   853 VIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEGSFSGDDLTGSGVAVFENDYYYEGELTLLG 917
             :||.:...|.:........|...|.:.:.    |.....:.||               ::|.| 
Zfish   780 -VEDKLKKTKMVPTVVSEAASVSESALESE----ENQMKDNPLT---------------KVTSL- 823

  Fly   918 PNGRGEYYMPSGDACGGSGAMGTGEFDDTCELIGNKMFGQLSGTWDTVRIQAGELVLNRRFP-KY 981
                     ..|...|||..           |:|..:..||               |::..| :.
Zfish   824 ---------LQGMGMGGSAL-----------LVGEAVASQL---------------LSQSTPQEM 853

  Fly   982 PSSLGRQVVDHNRKWRSLFNNFESDLANCTASTSSSG------GNQSAGTLRKSSKPTLSTAQIW 1040
            |..|.||        |:|     ||:::.:.|...||      ..::|.|:...:.|..|.    
Zfish   854 PKPLSRQ--------RTL-----SDVSSLSESYDVSGQEEAREAERTAVTINVKADPDTSD---- 901

  Fly  1041 NCIAVYMSKQRAREGTKP------GNYFNNILLSLPLPQKTSSPLAKARTTTSALSKLQTEAASA 1099
                  ...:|:|..:|.      |.|           .:......:..:..|...:.:||....
Zfish   902 ------RDTERSRSESKTDAHSEMGTY-----------NRKEEESDEEESEGSVNERDETEDVEE 949

  Fly  1100 LDFLGFPPRRIQSQEALNSKPGGLQRADSLISMGHNTSRDLDNSSLASFQLDQSLMNST--VNGD 1162
            .|.||  .||.:|:|..:|.           |..|:...:.|:.|......|..:.:|:  ...:
Zfish   950 SDGLG--NRRDKSEEVEDSD-----------SKTHDKVGENDDDSEGDEDDDTMIKDSSEEEESE 1001

  Fly  1163 ESSTFNESFSKLSHNNNNSISKHMNNIDCSITSTTSTTSA 1202
            |..|.|::.:|.|..|.....:..:| |..:..|.:..|:
Zfish  1002 EEKTVNDTVTKASSENEEREEEEKSN-DSEVNDTMTKHSS 1040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 14/54 (26%)
RCC1_2 292..321 CDD:290274 13/29 (45%)
RCC1 308..361 CDD:278826 16/57 (28%)
PH-like 616..715 CDD:302622 23/154 (15%)
VPS9 1373..1479 CDD:280383
rpgrbNP_001299605.1 RCC1 54..102 CDD:278826 11/76 (14%)
RCC1 107..156 CDD:278826 13/49 (27%)
RCC1_2 143..172 CDD:290274 13/29 (45%)
RCC1 159..206 CDD:278826 16/57 (28%)
RCC1 209..259 CDD:278826 8/51 (16%)
RCC1 261..311 CDD:278826 11/55 (20%)
RCC1 314..365 CDD:278826 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.