DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and Jph4

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001003711.1 Gene:Jph4 RGDID:1303170 Length:630 Species:Rattus norvegicus

Alignment Length:474 Identity:114/475 (24%)
Similarity:170/475 (36%) Gaps:126/475 (27%)


  Fly   759 EYPDGSVYCGELQHGIIEGFGKMVIP-TTGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFC 822
            ::.||..|.|..:.|...|:|....| ..|.|.|.:..| |...||:     ..|....|:|::.
  Rat    10 DFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHG-FESLGVF-----TGPGGHSYQGHWQ 68

  Fly   823 EGLFHGHGVMRNNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFE 887
            :|...|.||.|.:|:.|.||:....:...||.|. |||.:|.|::.|..:.|.|:...:.|..::
  Rat    69 QGKREGLGVERKSRWTYRGEWLGGLKGRSGVWES-VSGLRYAGLWKDGFQDGYGTETYSDGGTYQ 132

  Fly   888 GSFSGDDLTGSGVAVFENDYYYEGELTLLGP------NGRGEYYMP------SGDACGGSGAMGT 940
            |.:......|.||.  ::..|::..| |..|      :|..:...|      .||. |||.|.|:
  Rat   133 GQWQAGKRHGYGVR--QSVPYHQAAL-LRSPRRTSLDSGHSDPPTPPPPLPLPGDE-GGSPASGS 193

  Fly   941 -GEFDDTCELIGNKMFGQLSGTWDTVRIQAG------ELVLN------RRFPKYPSSLGRQVVDH 992
             |.|    .|.|.   |...|.....|..|.      .|:|:      ||     ||||      
  Rat   194 RGGF----VLAGP---GDADGASSRKRTPAAGGFFRRSLLLSGLRAGGRR-----SSLG------ 240

  Fly   993 NRKWRSLFNNFESDLANCTASTSSSGGNQS-------------------AGTLRKSSKPTLSTAQ 1038
                 |...:..|::::...||...|...|                   ||..|...:.....:|
  Rat   241 -----SKRGSLRSEVSSEVGSTGPPGSEASGPPIPAPPALIEGSATEVYAGEWRADRRSGYGVSQ 300

  Fly  1039 IWNCI---AVYMSKQRAREG--TKP------GNYFNNILLS-------LPL-------PQKTSSP 1078
            ..|.:   ..::..:|...|  |:|      |.|..|.|:.       |||       .:|....
  Rat   301 RSNGLRYEGEWLGNRRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLALRRGKVKEKVDRA 365

  Fly  1079 LAKARTTTSALSK-------------LQTEAASALDFLGFPPRRI-----QSQEALNSKPGGLQR 1125
            :..||...||..:             |:..|||::........|:     |..:.:...||...|
  Rat   366 VEGARRAVSAARQRQEIAAARAADALLKAVAASSVAEKAVEAARMAKLIAQDLQPMLEAPGRRPR 430

  Fly  1126 ADSLISMGHNTSRDLDNSS 1144
            .||    |.:.:..||..|
  Rat   431 QDS----GGSDTEPLDEDS 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Jph4NP_001003711.1 MORN 1. {ECO:0000255} 17..39 6/22 (27%)
MORN 2. {ECO:0000255} 41..62 7/27 (26%)
MORN 3. {ECO:0000255} 63..84 8/21 (38%)
MORN 4. {ECO:0000255} 85..107 9/23 (39%)
MORN 5. {ECO:0000255} 108..130 6/22 (27%)
MORN 130..>145 CDD:197832 3/15 (20%)
MORN 6. {ECO:0000255} 131..153 5/24 (21%)
MORN 7. {ECO:0000255} 284..306 5/22 (23%)
MORN 307..329 CDD:280628 4/22 (18%)
MORN 8. {ECO:0000255} 307..329 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.