DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Morn4

DIOPT Version :10

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001020146.1 Gene:Morn4 / 293950 RGDID:1307336 Length:146 Species:Rattus norvegicus


Alignment Length:116 Identity:38/116 - (32%)
Similarity:60/116 - (51%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 YPDGSVYCGELQHGIIEGFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEG 824
            |..|..|.||.:.|...|||:::....|.|:|:|:.|.|:|.||...     .:...|||.|.:|
  Rat    10 YSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTF-----SDGSRYEGEFSQG 69

  Fly   825 LFHGHGV-MRNNRYIYVGEYQANARSGYGVI--EDLVSG-DKYMGMFADNK 871
            .|:|.|| :|.:...:.||::.....|:|::  .|...| .:..|:|.:||
  Rat    70 KFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGLPRNEGLFENNK 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 ATS1 <238..>367 CDD:444065
PH-like 616..715 CDD:473070
COG4642 <745..890 CDD:443680 38/116 (33%)
PLN03185 835..>962 CDD:215619 10/40 (25%)
VPS9 1373..1479 CDD:460489
Morn4NP_001020146.1 COG4642 <5..118 CDD:443680 36/112 (32%)
MORN 1 16..38 7/21 (33%)
MORN 2 39..61 8/26 (31%)
MORN 3 62..84 10/21 (48%)
MORN 4 85..107 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.