DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and Morn4

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001020146.1 Gene:Morn4 RGDID:1307336 Length:146 Species:Rattus norvegicus

Alignment Length:116 Identity:38/117 (32%)
Similarity:60/117 (51%) Gaps:9/117 (8%)


  Fly   760 YPDGSVYCGELQHGIIEGFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEG 824
            |..|..|.||.:.|...|||:::....|.|:|:|:.|.|:|.||...     .:...|||.|.:|
  Rat    10 YSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTF-----SDGSRYEGEFSQG 69

  Fly   825 LFHGHGV-MRNNRYIYVGEYQANARSGYGVI--EDLVSG-DKYMGMFADNK 871
            .|:|.|| :|.:...:.||::.....|:|::  .|...| .:..|:|.:||
  Rat    70 KFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGLPRNEGLFENNK 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Morn4NP_001020146.1 COG4642 5..106 CDD:226989 33/101 (33%)
MORN 1 16..38 8/22 (36%)
MORN 16..35 CDD:197832 7/19 (37%)
MORN 39..61 CDD:280628 8/27 (30%)
MORN 2 39..61 8/27 (30%)
MORN 3 62..84 10/22 (45%)
MORN 4 85..107 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.