DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and Rsph10b

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_006248920.1 Gene:Rsph10b RGDID:1311893 Length:906 Species:Rattus norvegicus

Alignment Length:371 Identity:82/372 (22%)
Similarity:144/372 (39%) Gaps:93/372 (25%)


  Fly   606 SSNDRNPRIV-QFRGRHRRVILTSALVPLKLVTSGISRSSNSFILFSDFLCQVSGNSLYSYP-LT 668
            ||...||... |.....::.:..||::|  ::.:.:.::...   .|:...|....:.|..| ||
  Rat    20 SSISDNPEAAKQEISASKQEVAPSAVIP--VLETPLKQTPKR---DSEHTYQSEDETQYEEPILT 79

  Fly   669 TLWVWT-EGDSLRLTTPEKSFLV--STRSQEMRKVWLD---QLQSSIIASLGKPLGSPVPSYRST 727
            .|.|.: ||:.:|.....:.|.|  ...:...|.:|:.   ::.::::..|..|..       ||
  Rat    80 KLIVESYEGEKVRGLYEGEGFAVFQGGNTYHDRSLWMRGRLRVGTTLLLLLLLPSA-------ST 137

  Fly   728 GYEFSREHPKFSRVKACGTWRKGVLHG-NCYL----------------------EYPDGSVYCGE 769
            ..:              |.:.:|::|| ..|:                      .:||||.|.||
  Rat   138 SLQ--------------GMFSEGLMHGQGTYIWADGLKYEGDFVKNIPMNHGVYTWPDGSTYEGE 188

  Fly   770 LQHGIIEGFGKMVIPTTGL-YVGNFKGGRFHGHG----------------VYE------MHCKDS 811
            :.:|:..|||.....|..: |:|::..|:.||.|                ||.      :.|..|
  Rat   189 VVNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKS 253

  Fly   812 PESEVYEGNFCEGLFHGHGVMR--NNRYIYVGEYQANARSGYGV----IEDLVSG-----DKYMG 865
              ..:|||.:...:.||.|.||  .....|.|.::...::|:|.    ::.:.:.     ::|:|
  Rat   254 --GNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIG 316

  Fly   866 MFADNKRSGIGSCITNRGDYFEGSFSGDDLTGSGVAVFENDYYYEG 911
            .|.:..|.|.|......|..:||.:..:...|.|...|:|...|||
  Rat   317 AFVNGFRHGQGKFYYASGAMYEGEWVSNKKQGRGRITFKNGRVYEG 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622 20/106 (19%)
VPS9 1373..1479 CDD:280383
Rsph10bXP_006248920.1 COG4642 82..222 CDD:226989 34/161 (21%)
MORN 140..159 CDD:280628 5/33 (15%)
COG4642 152..364 CDD:226989 51/214 (24%)
MORN 162..184 CDD:280628 4/22 (18%)
MORN 255..274 CDD:197832 8/19 (42%)
MORN 314..336 CDD:280628 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.