DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and HECTD4

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001103132.4 Gene:HECTD4 HGNCID:26611 Length:4428 Species:Homo sapiens

Alignment Length:795 Identity:165/796 (21%)
Similarity:265/796 (33%) Gaps:280/796 (35%)


  Fly   850 GYGVIEDLV-SGDKYMGMFADNKRSGIGSCITNRGDYFEGSFS---GDDLTGSGVAVFENDYYYE 910
            ||   ||:: :.|...|..::||.:.:|.|:|..|.|...:.|   |....|||:         .
Human   286 GY---EDMLPAPDSNTGSSSENKDADLGRCLTADGLYLYTTNSVGRGVSKLGSGL---------H 338

  Fly   911 GELTLLGPNGRGEYYMPSGDACGGSGAMGTG-------EFDD---------------TCELI--- 950
            |.|       ||..|..:.:...|..|.|:|       .||:               .|:::   
Human   339 GTL-------RGFVYCRNEELEPGWVAFGSGSLLHRPVSFDNKPHSLFQVIDQNTLQVCQVVPMP 396

  Fly   951 GNKMFGQLSGTWDTVRIQA---------GELVLNRRFPKYPSSLGRQVVDHNRKWRSLFNNFESD 1006
            .|.:  .:..|..||.:.:         ....||.:.||     |..|         ..:.||..
Human   397 ANHL--PIGSTMSTVHLSSDGTYFYWIWSPASLNEKTPK-----GHSV---------FMDIFELV 445

  Fly  1007 LANCTASTSSSGGNQSAGTLRKSSKPTLSTAQIWNCIAVYMSKQRAREGTKPGNYFNNILLSLPL 1071
            :.|         |...|..|::.:              :.|.|    || :.....|.:||| .|
Human   446 VEN---------GVFVANPLQERT--------------ILMRK----EG-ESAKSINEMLLS-RL 481

  Fly  1072 PQKTSSPLAK-ARTTTSALSKLQTEAASALDFLGFPPRRIQ---------------------SQE 1114
            .:..:||.|. |..|.|.:|....|..:|....|.|.:.::                     ...
Human   482 SRYRASPSATLAALTGSTISNTLKEDQAANTSCGLPLKMLRKTPIYTCGTYLVMLVPPPGGSGSS 546

  Fly  1115 ALNSKPGGLQRADSL----------ISMGHNTSR----DLDNSSLASFQLDQSL--MNSTVNGDE 1163
            |..|..||.....||          ||.|..|||    |...|||....|...|  ...|||...
Human   547 ATRSLFGGTSGLSSLKILASSLVYNISDGQFTSRADLIDAAGSSLGRGALVPGLGACYDTVNNML 611

  Fly  1164 SSTFNESFSKLSHNNNNSISKHMNNIDCS--ITSTTS---TTSAVLDQV---------------- 1207
            .:..|:...:..:..|.:.......:..|  ||....   ||:.|::|:                
Human   612 WTCSNDYIDQWCNPGNQAFHYVCQRLGVSHIITEPKEEAITTNEVINQLLHHVGAMCIHQLNLLA 676

  Fly  1208 --PSFGMALVLTEQ------DVTSIRLYLEQAFKDRHHPLYVLNERIANC--------FHYSYGY 1256
              |:..:..||.:|      .::||...:|:|..:.       :..|..|        |.:.:..
Human   677 TNPNLPITSVLGKQHPIEAHHLSSICDIMEKAMVNG-------DTCIIRCILVVFQVVFKFFFSP 734

  Fly  1257 WKVKPTPILAKQAMREWESISRRIYRFVRKMFPALPEELC---QMEGSREVISHITLLYP----- 1313
            ...:...|:.:..:..|:            :..|..:::|   |.|....:.|.:.:|||     
Human   735 QTERNRDIIRRSGLLLWQ------------LLMAPKDQICPEIQKEVCLAISSGLNILYPGETEI 787

  Fly  1314 -----LVLSEG------------IYSTLF-VLYANKY-SRKDEMYRQNLNLAEKL---------- 1349
                 |||:||            |.:.|. .|..|:: |.:|:.||.|..|...:          
Human   788 NNLLKLVLTEGERNSGLSQLRDVILTNLAEQLQNNRFGSDEDDHYRLNDELLHYILKIVVRESCI 852

  Fly  1350 ---------KD--QELVE-----------LMGHESFL--HNVMLDPKFVESVQTLKELQ-EKFSP 1389
                     ||  |:|:.           ||..::.|  :.:::.|.  |:..:...|| |....
Human   853 LITKCQTVSKDDFQKLLSTVPAASSCLRYLMAVQNHLLSNTILIKPD--ENDDSDSSLQGETLKV 915

  Fly  1390 QDM-LTVIQRSTQLLT---EAYEHAMAANAAQLNAD---------NMIPLTMLTMLRAAVPHLGA 1441
            |:: ::::..:||:||   |..|.......|.:|:|         .:..:|..|||...:|    
Human   916 QELKVSILALATQILTGCDEVLEMLQQVTTALINSDIADREQRLKGLEQVTKATMLGHLLP---- 976

  Fly  1442 ELALLDDLTGGPNFQ 1456
              .||..|. .||.|
Human   977 --VLLTSLM-HPNLQ 988

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383 25/99 (25%)
HECTD4NP_001103132.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.