DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and Sergef

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_006541006.1 Gene:Sergef MGIID:1351630 Length:465 Species:Mus musculus

Alignment Length:412 Identity:89/413 (22%)
Similarity:143/413 (35%) Gaps:142/413 (34%)


  Fly    88 DFC--------SGSQELFVVLTNGSVQRQATGSGRD--VGHPHAWQTLGF---DPLELHAEGVRI 139
            |||        :|......|:|:|. .....|..:|  :|..|..:.|.|   .||    .|..|
Mouse    45 DFCQAGCIKSVTGGGGHSAVVTDGG-DLFVCGLNKDGQLGLGHTEEVLRFTICKPL----RGCPI 104

  Fly   140 RRVCCSAQGVVFVGASGETYVMGSCGEVFKAEQQ------------PRHMRLYEEGKELLDLAAG 192
            |:|.|.....:.:...|:..   |||.  .|..|            |:.:....|  :::.:|||
Mouse   105 RQVACGWDFTIMLTEKGQVL---SCGS--NAFGQLGVPHGPRKCVVPQAIECLRE--KVVCVAAG 162

  Fly   193 NEHFVMLVAP-------YNLADDALQLS-------VASAKEEP-----EDERASVKSISSGHSER 238
            ..|.:...|.       ..||....:|.       ..:|||..     |:..|......|.||. 
Mouse   163 LRHALATTATGSVFQWGTGLASSGRRLCPGQNLPLFLTAKEPSRVTGLENSTAVCAVAGSDHSA- 226

  Fly   239 SVAANTRHLLHQGYALLHT-QLFTFGASNNGLLGSGDHIRRANVMRL-QKLDS-----MGVCSIA 296
                          :|..| :|:.:|.:.:|.|.|     ||..:.| |::::     ..|.::.
Mouse   227 --------------SLTDTGELYVWGRNKHGQLAS-----RAVFLPLPQRIEAHYFQDEKVTAVW 272

  Fly   297 AGLEHTVARTLDGRLYHWGLNNHSQLGEDVSSPMEITITENTAALPIEQNSAL------------ 349
            :|..|.||:|..|:::.||..::.|||..:..|        .|..|:||:|:|            
Mouse   273 SGWTHLVAKTETGKVFTWGRADYGQLGRRLEPP--------EAQKPVEQDSSLAFQGPQNSVPSP 329

  Fly   350 --------EATCGDYHTLL---------------LNASGQIHSLQPAPPMRHLQQSSTYAQTLLQ 391
                    |.:||..|.|.               :...|...::....|::.|..|         
Mouse   330 LHCLTGATEISCGSEHNLAVIRDKCCSWGWNEHGMCGDGTESNVWTPTPVQALPPS--------- 385

  Fly   392 LQLGAAWPRQLRLLMCSGGYTL 413
                   |.:|.|:.|..|::|
Mouse   386 -------PSRLLLVGCGAGHSL 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 13/52 (25%)
RCC1_2 292..321 CDD:290274 9/29 (31%)
RCC1 308..361 CDD:278826 18/88 (20%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
SergefXP_006541006.1 RCC1 22..65 CDD:278826 5/20 (25%)
RCC1 69..117 CDD:278826 13/53 (25%)
RCC1_2 104..133 CDD:290274 9/34 (26%)
RCC1 120..168 CDD:278826 12/55 (22%)
RCC1_2 219..244 CDD:290274 8/40 (20%)
RCC1 232..280 CDD:278826 13/53 (25%)
RCC1 285..349 CDD:278826 18/72 (25%)
RCC1 356..402 CDD:278826 10/62 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.