DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and Hectd4

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_006530414.1 Gene:Hectd4 MGIID:3647820 Length:4525 Species:Mus musculus

Alignment Length:821 Identity:171/822 (21%)
Similarity:263/822 (32%) Gaps:332/822 (40%)


  Fly   850 GYGVIEDLV-SGDKYMGMFADNKRSGIGSCITNRGDYFEGSFS---GDDLTGSGVAVFENDYYYE 910
            ||   ||:: :.|...|..::||.:.:|.|:|..|.|...:.|   |....|||:         .
Mouse   380 GY---EDMLPAPDSNTGSSSENKDADLGRCLTADGHYLYTTNSAGRGVSKLGSGL---------H 432

  Fly   911 GELTLLGPNGRGEYYMPSGDACGGSGAMGTGEFDDTCELIGNKMFGQLSGTWDTVRIQAGELVLN 975
            |.|       ||..|..:.:...|..|.|.|.                              :|:
Mouse   433 GTL-------RGFVYCRNEELEPGWVAYGNGH------------------------------LLH 460

  Fly   976 R--RFPKYPSSLGRQVVDHNRKWRSLFNNFESDLANC-----TASTSSSGGNQSAGTLRKSSKPT 1033
            |  .|...|.|| .||:|.|            .|..|     .||....|...|  |:..||..|
Mouse   461 RPVSFDNKPHSL-FQVIDQN------------TLQVCQTVPMPASPLPVGSTMS--TVHLSSDGT 510

  Fly  1034 LSTAQIWNCIAVYMSKQRAREGTKPGNYF----------NNILLSLPLPQKT------------- 1075
            . ...||       |.....|.|..|:..          |.:.::.||.::|             
Mouse   511 Y-FYWIW-------SPASLNEKTPKGHSVFMDIFELVVENGVFVANPLQERTILMRKEGESAKSI 567

  Fly  1076 ------------SSPLAK-ARTTTSALSKLQTEAASALDFLGFPPRRIQSQE---------ALNS 1118
                        :||.|. |..|.|.:|....|..:|....|.|.:.::...         .|..
Mouse   568 NEMLLSRLSRYRASPSATLAALTGSTISNTLKEDQAANTSCGLPLKMLRKTPMYTCGTYLVMLVP 632

  Fly  1119 KPGGLQRADSLISMGHNTSRDL--DNSSLASFQ-LDQSLMNSTVNGDESSTFNESFSKLSHNNNN 1180
            .|||         .|.:.:|.|  ..|.|:|.: |..||:.:..:|..:|.     :.|.....:
Mouse   633 PPGG---------SGSSATRSLFGGTSGLSSLKILASSLVYNISDGQFASR-----ADLIDAAGS 683

  Fly  1181 SISK------------HMNNI--DCSITSTTSTTSAVLDQ------------VPSFGMALVLTEQ 1219
            |:.:            .|||:  .||        :..:||            ....|::.::||.
Mouse   684 SLGRGALVPGLGACYDTMNNMLWTCS--------NDYIDQWCNPGNQAFHYVCQRLGVSHIITEP 740

  Fly  1220 DVTSIRLYLEQAFKDRHHPLYVLNERI----ANCFHYSYGYWKVKP----TPILAKQAMREWESI 1276
            .        |:|.....    |:|:.:    |.|.| ........|    |.:|.||...|...:
Mouse   741 K--------EEAISTNE----VINQLLHHVGAMCIH-QLNLLATNPNLPITSVLGKQHPIEARHL 792

  Fly  1277 S-------------------------RRIYRF------------VRK-------MFPALPEELC- 1296
            |                         :.:::|            :|:       :..|..:::| 
Mouse   793 SSICDIMEKAMVNGDTCIVRCILVVFQVVFKFFFSPQTERNRDIIRRSGLLLWQLLMAPKDQICP 857

  Fly  1297 --QMEGSREVISHITLLYP----------LVLSEG------------IYSTLF-VLYANKY-SRK 1335
              |.|....:.|.:.:|||          |||:||            |.:.|. .|..|:: |.:
Mouse   858 EIQKEVCLAISSGLNILYPGETEINNLLKLVLTEGERNSGLSQLRDVILTNLAEQLQNNRFGSDE 922

  Fly  1336 DEMYRQNLNLAEKL-------------------KD--QELVE-----------LMGHESFL--HN 1366
            |:.||.|..|...:                   ||  |:|:.           ||..::.|  :.
Mouse   923 DDHYRLNDELLHYILKIVVRESCILITKCQTVSKDDFQKLLSTVPAASSCLRYLMAVQNHLLSNT 987

  Fly  1367 VMLDPKFVESVQTLKELQ-EKFSPQDMLT-VIQRSTQLLT---EAYEHAMAANAAQLNADNMIP- 1425
            |::.|.  |:..:...|| |....|::.| ::..:||:||   |..|.......|.:|:|  || 
Mouse   988 VLIKPD--ENEDSDSSLQGETLKVQELKTSILALATQILTGCDEVLEMLQQVTTALINSD--IPD 1048

  Fly  1426 ----------LTMLTMLRAAVPHLGAELALLDDLTGGPNFQ 1456
                      :|..|||...:|      .||..|. .||.|
Mouse  1049 REQRLKGLEQVTKATMLGHLLP------VLLTSLM-HPNLQ 1082

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383 28/101 (28%)
Hectd4XP_006530414.1 SPRY_HECT_like 2507..2662 CDD:293970
HECTc 4127..4520 CDD:294058
HECTc 4167..4516 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.