DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and RCC1

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001041659.1 Gene:RCC1 HGNCID:1913 Length:452 Species:Homo sapiens

Alignment Length:404 Identity:90/405 (22%)
Similarity:139/405 (34%) Gaps:121/405 (30%)


  Fly    33 RGLPPLQRFPASRICSNAGG-ELLLLTTDHALYSAKLQANREHMDLQLLR-TDVVDMDFCSGSQE 95
            |..|.|...|...:.:.||| ..:.|:....:||  ...|.|.   .|.| |.|...:...|..|
Human    88 RKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYS--FGCNDEG---ALGRDTSVEGSEMVPGKVE 147

  Fly    96 LFVVLTNGSVQRQATGSGRDVGHPHAWQT-------LG-FDPLELHAEGVRIR------RVCCSA 146
            |...:...|.....|.:..|.|....|.:       :| .:|::.....|:::      :|....
Human   148 LQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGN 212

  Fly   147 QGVVFVGASGETYVMGSCGE-----------------------------VFKAEQQPRHMRLYE- 181
            ..:|.:.|.|:.|.:| |||                             :.|:.....|:|..: 
Human   213 DHLVMLTADGDLYTLG-CGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDA 276

  Fly   182 ------------EGKELLDLAAGNEH----------FVMLVAPYNLADDALQLSVASAKEEPEDE 224
                        || .:......|.|          |:    |.||         .|.|.     
Human   277 FCGAYFTFAISHEG-HVYGFGLSNYHQLGTPGTESCFI----PQNL---------TSFKN----- 322

  Fly   225 RASVKSI--SSGHSERSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRL-QK 286
              |.||.  .||....:|..::     :|.|      ::.|.:..|.||.|:.....::..| .:
Human   323 --STKSWVGFSGGQHHTVCMDS-----EGKA------YSLGRAEYGRLGLGEGAEEKSIPTLISR 374

  Fly   287 LDSMGVCSIAAGLEHTVARTLDGRLYHWGLNNHSQLG----EDVSSPMEITITENTAALPIEQNS 347
            |.:  |.|:|.|.....|.|.|||::.||:..:.|||    ||..||:|:      ....:|...
Human   375 LPA--VSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEM------MGKQLENRV 431

  Fly   348 ALEATCGDYHTLLL 361
            .|..:.|..||:||
Human   432 VLSVSSGGQHTVLL 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 11/47 (23%)
RCC1_2 292..321 CDD:290274 11/29 (38%)
RCC1 308..361 CDD:278826 19/57 (33%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
RCC1NP_001041659.1 RCC1 66..113 CDD:278826 7/25 (28%)
RCC1 116..165 CDD:278826 13/54 (24%)
RCC1 168..218 CDD:278826 7/50 (14%)
RCC1 221..286 CDD:278826 9/66 (14%)
RCC1 289..340 CDD:278826 16/72 (22%)
RCC1 343..386 CDD:278826 13/51 (25%)
RCC1 394..445 CDD:278826 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.