DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Als2 and eea1

Sequence 1:NP_649347.1 Gene:Als2 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:XP_002935361.1 Gene:eea1 XenbaseID:XB-GENE-490092 Length:1402 Species:Xenopus tropicalis

Alignment Length:424 Identity:83/425 (20%)
Similarity:159/425 (37%) Gaps:108/425 (25%)


  Fly  1071 LPQKTSS------PLAKAR-----------TTTSALSKLQTEAASALDFLGFPPRRIQSQEALNS 1118
            |.:|||:      .|.|.|           .|||.|.:.|.:....|..:|...::||:.|||  
 Frog   464 LKEKTSASTDLQHQLEKIRQQHQEQTNLQQNTTSKLREAQNDLEQVLRQIGDKDQKIQNLEAL-- 526

  Fly  1119 KPGGLQRADSLISMGHNTSRDLDNSSLASFQLDQSLMNSTVNGDESSTFNESFSKLSHNNNNSIS 1183
                |:::...||:......|| .:.:.:.:.:.:::|..  .:::....|..::|:....|...
 Frog   527 ----LEKSKKNISLLEKEREDL-YAKIQAGEGETAVLNQL--QEKNHALQEQLTQLTEKLKNQSE 584

  Fly  1184 KH---MNNIDCSITSTTSTTSAVLDQVPSFGMALVLTEQDVTSIRLYLEQAFKDRHHPLYVLNER 1245
            .|   ..|:...:....|...|..|:|    :||..|..:|||       ...:....:..|:.:
 Frog   585 SHKQAQENLHEQVQEQKSQLRASQDRV----LALEATLNEVTS-------QLNESKEKMVQLDLQ 638

  Fly  1246 IANCFHYSYGYWKVKPTPILAKQA-----------------------MREWESISRRIYRFVRKM 1287
            |           |.|...:||.:|                       .:|...::.::.:...|:
 Frog   639 I-----------KAKTELLLAAEAAKTAQRVDLQNHLDTAQNALQDKQQELNKVNAQLEQVTAKL 692

  Fly  1288 FPALPEELCQMEGSREVI--SHITLLYPLVLSEG----IYSTLFVLYANKYSRKDEMYRQNLNLA 1346
            ... .|...|:|.:.:..  .|:.|.......||    :.:.|..:.||:.....|:.:|....|
 Frog   693 NDK-QEYSIQLEANLKEYKEKHLNLEQKSEALEGQLKKLETDLISVKANREQTTQELQQQKQQSA 756

  Fly  1347 E-KLKDQELVELMGHESFL------------HNVMLDPKFV-----------ESVQTLKELQEKF 1387
            : :||..||.:.:..|..|            .::....:|:           |:::.||:..||.
 Frog   757 QMELKSAELSKQLEEEKGLVSSMKLELQKKVESLQQSKEFISKQDQERNSLKENIEKLKQDLEKI 821

  Fly  1388 S--PQDMLTVIQRSTQLLTEAYEHAMAANAAQLN 1419
            |  .||.:|.::: |:|..:|.:..:|....:|:
 Frog   822 SGKMQDAVTSLEK-TKLERDALQKDLAETKKKLS 854

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826
RCC1_2 292..321 CDD:290274
RCC1 308..361 CDD:278826
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383 15/61 (25%)
eea1XP_002935361.1 Smc 308..1075 CDD:224117 83/425 (20%)
Phage_GPO <879..1002 CDD:301727
FYVE_EEA1 1338..1400 CDD:277269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.