DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr78E and Cpr65Ax2

Sequence 1:NP_649345.1 Gene:Cpr78E FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001261467.1 Gene:Cpr65Ax2 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster

Alignment Length:117 Identity:48/118 (41%)
Similarity:63/118 (53%) Gaps:19/118 (16%)


  Fly     2 FKILIVALSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGE--DGTHRREEAV 64
            |.|::.||   .||.|:||.          |.:|.|....   |..|:||..|  |||.:.||.|
  Fly     3 FAIVLFAL---FAVALAAPT----------VEVLRSDSNV---GIDNYSYAVETSDGTSKSEEGV 51

  Fly    65 VRNQGTENEYLEISGSYSYFDANGQEVTVTYKADDHGFVPEGGAILPQISLA 116
            ::|.|||.|.:...||:||...:||..||||.||::||.|: ||.||...:|
  Fly    52 LKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQ-GAHLPVAPVA 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:278791 28/57 (49%)
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.