DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78E and Cpr65Ax1

DIOPT Version :10

Sequence 1:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster


Alignment Length:117 Identity:48/117 - (41%)
Similarity:63/117 - (53%) Gaps:19/117 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKILIVALSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGE--DGTHRREEAV 64
            |.|::.||   .||.|:||.          |.:|.|....   |..|:||..|  |||.:.||.|
  Fly     3 FAIVLFAL---FAVALAAPT----------VEVLRSDSNV---GIDNYSYAVETSDGTSKSEEGV 51

  Fly    65 VRNQGTENEYLEISGSYSYFDANGQEVTVTYKADDHGFVPEGGAILPQISLA 116
            ::|.|||.|.:...||:||...:||..||||.||::||.|: ||.||...:|
  Fly    52 LKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQ-GAHLPVAPVA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 27/56 (48%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:459790 26/54 (48%)

Return to query results.
Submit another query.