DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr78E and Cpr78Ca

Sequence 1:NP_649345.1 Gene:Cpr78E FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster

Alignment Length:125 Identity:33/126 (26%)
Similarity:50/126 (40%) Gaps:22/126 (17%)


  Fly    15 VVLSAPVDHVTSTTQPPV--AILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRNQGTENEYLEI 77
            |::...:.|.|..|.|.:  .|...:......|.|:|.:...:|        :..:|..||...:
  Fly    12 VLVLVQLIHCTRFTAPSLDRTIYYRNTPPDPFGHYSFEFQTTNG--------ITTKGAGNENGAV 68

  Fly    78 SGSYSYFDANGQEVTVTYKADDHGFVPEGGAILPQISLAAKQVSEQVPQPDLDYAK--PP 135
             |...:....|..||.:|.||.:|:.|.|..| |.|.|   .|..|     |:|.:  ||
  Fly    69 -GVVQFVSPEGIPVTFSYVADANGYQPTGDHI-PAIPL---HVIRQ-----LEYIRTHPP 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:278791 14/55 (25%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.