DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78E and l(3)mbn

DIOPT Version :10

Sequence 1:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:131 Identity:30/131 - (22%)
Similarity:44/131 - (33%) Gaps:47/131 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSLCTAV-VLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRNQGTEN 72
            |.|||.. ||||      :||..|               |.|.:..::..||.|:        .:
  Fly    13 LLLCTLTHVLSA------ATTVRP---------------YKFGFTIDEQQHRAEK--------RD 48

  Fly    73 EYLEISGSYSYFDANGQEVTVTYKADDHG--------FVPEGGAI---------LPQISLAAKQV 120
            |...|.|.:.:..|:|......|..|:.|        ..|..|.:         .|::.|.|..|
  Fly    49 ERGIIMGEFGFITADGIYHVTVYATDEEGKFRIISMKSYPYAGPVGSKSVPVTTTPKVLLPAAPV 113

  Fly   121 S 121
            :
  Fly   114 A 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 13/62 (21%)
l(3)mbnNP_729143.2 Chitin_bind_4 575..621 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.