DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr78E and l(3)mbn

Sequence 1:NP_649345.1 Gene:Cpr78E FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster

Alignment Length:131 Identity:30/132 (23%)
Similarity:44/132 (33%) Gaps:47/132 (36%)


  Fly     9 LSLCTAV-VLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRNQGTEN 72
            |.|||.. ||||      :||..|               |.|.:..::..||.|:        .:
  Fly    13 LLLCTLTHVLSA------ATTVRP---------------YKFGFTIDEQQHRAEK--------RD 48

  Fly    73 EYLEISGSYSYFDANGQEVTVTYKADDHG--------FVPEGGAI---------LPQISLAAKQV 120
            |...|.|.:.:..|:|......|..|:.|        ..|..|.:         .|::.|.|..|
  Fly    49 ERGIIMGEFGFITADGIYHVTVYATDEEGKFRIISMKSYPYAGPVGSKSVPVTTTPKVLLPAAPV 113

  Fly   121 S 121
            :
  Fly   114 A 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:278791 13/63 (21%)
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791 12/54 (22%)
Chitin_bind_4 575..621 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.