DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and mgl

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_001096924.2 Gene:mgl FlyBaseID:FBgn0261260 Length:4769 Species:Drosophila melanogaster

Alignment Length:1426 Identity:460/1427 (32%)
Similarity:727/1427 (51%) Gaps:111/1427 (8%)


Human    20 APLLLYANRRDLRLVD-ATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKT 83
            |..|:.:||..:.:.| ...|.|...|:|   |:..|.......|.|:|||:..:.|.|  .::.
  Fly  1560 AAFLIISNRHSILVADLKEQGLERVPIIV---ENVVATASNMHTGTIFWSDMKLKKISR--LDRG 1619

Human    84 ESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPS 148
            ...|.::.:||...:|||.||:.:.|||.||:.|.||||..:||.|.||..:.:.|||.:.:|||
  Fly  1620 MEPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNRLVLVRENITQPRGMCIDPS 1684

Human   149 SG--FMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNL 211
            .|  :::||||||.|::||.||||:.|..|||::||||||||||...:::|:||:||:||.....
  Fly  1685 PGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGLTLDIATKRVYFADSKLDFIDFCYY 1749

Human   212 DGTNRQAVVKGS--LPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAF 274
            :||.||.|:..|  |.||.:|:||||.|||||...:.:|:.||:.|:....:...|..|:.||..
  Fly  1750 NGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQLNRVLSANKFRGKNQTVVSHLISQPLSIHVH 1814

Human   275 SQQRQPNATNPCGIDNGGCSHLCLMSPVKP-FYQCACPTGVKLLENGKTCKDGATELLLLARRTD 338
            ....||...|||.  ...|.||||:||..| .|.|.|..|.|||..|: |.:.....|::.:.|.
  Fly  1815 HASLQPMTPNPCA--GSRCQHLCLLSPSAPEGYSCKCRPGFKLLSEGR-CIEEENPFLMVVKGTQ 1876

Human   339 LRRISLDTPDF-TDIVLQLEDIRHAIAIDYDPVEGYIYWT-----DDEVRAIRRSFIDGSGSQFV 397
            :..:.|:..|. ...:..:..|..:..:|:|.....:||.     |||...|..:...|......
  Fly  1877 IVDLPLNGGDARAGALAPVIGIESSTGLDFDRKGETLYWVQGREDDDENCTIYTTPYGGGNKTLF 1941

Human   398 VTAQ---IAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTM--RKILISED-----LEEPRAIV 452
            :..:   :..|..||.||:.||||..:.....||..|::|..  |.|:::.|     :..|:.|.
  Fly  1942 LGIENGIVGAPYTIAFDWLGRNLYIGNRVASNIEAVRVDGKQKYRTIILANDGYPNSVSRPKQIA 2006

Human   453 LDPMVGYMYWTDWG--EIP-KIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKI 514
            |||..|.::|.|.|  |:| ||.|..::|.:.:| |......|..||:|.::..:|:..:....|
  Fly  2007 LDPTEGKLFWIDEGVLEVPIKIGRVDMNGQNPIV-VFQEFAHPESLAVDTEKKMVYYSASNPAVI 2070

Human   515 EVMNTDGTGRR-VLVEDK----IPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAER-EVIIDQLP 573
            .||:.:|.... :|::|.    .|...|  :|...:|:.|.....|.|:.....:. :.|:|...
  Fly  2071 GVMDYNGDDHTLILMKDSHPMAKPRSLG--ILDHRLYYLDPLYERIVRIDLPHGDNPKTIVDNES 2133

Human   574 DLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLR-CACPIGFELISDMKTCIVPEAFLLFS 637
            ||..:.... .|.:..:||...||||.|||:..|...| |||.||:...::: .|:..:.|.:.|
  Fly  2134 DLRSMMIYK-KRALMQHPCQTNNGGCKHLCIPGPGATRTCACGIGYRKENEI-NCVAYKIFAVVS 2196

Human   638 RRADIRRISLETNNNNVAIPLTGVKEASALDFDV--TDNRIYWTDIS---LKTISRAFMNGSALE 697
            :...||..|| ::::...:|::|... ..|..||  .:..|||.:.:   ...|.|:..||:.|:
  Fly  2197 QLDMIRGYSL-SDSSEAMVPISGPGH-HILHVDVMYREQWIYWAEYNRGYWNGIFRSRPNGTDLQ 2259

Human   698 HVVEFGL--DYPEGMAVDWLGKNLYWADT--GTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPA 758
            |||:.|:  :...|:.:||:..|:|:.:.  ..|.:||..|||.:|:|||....|:||.||::|.
  Fly  2260 HVVKDGIGSNGIRGLTIDWVAGNMYFTNVYPHENYVEVCWLDGSNRKVLVKTTTDAPRELAVNPI 2324

Human   759 EGFMYWTEWGGKPKIDRAAMDGSERTTLVPN-VGRANGLTIDYAKRRLYWTDLDTNLIESSNMLG 822
            :..:||.::|..|:|.:|.:|||:.|.||.: :.....||||.....:||.|...:.|:..:..|
  Fly  2325 KRLLYWIDYGQHPRIGKALLDGSKWTPLVTSGISLPRDLTIDMQTHDIYWVDSKLDTIQKISYNG 2389

Human   823 LNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANK-TSGQNRTIIQGHLDYVMDILVF--HS 884
            .||::|..|||:|.|:..|.:.:||.|.:..::.:|:| ::.:..|.::.:|:.:.||.::  ::
  Fly  2390 ANRKIIRRDLPNPMGIAVYLNDVYWVDRNLMTVFKASKHSANETATSVRTNLEKLRDIAIYNINN 2454

Human   885 SRQSGWNECAS-SNGHCSHLCLAVPVGG----------FVCGCPAHYSLNADNRTCSAPTTFLLF 938
            ..|...|.||. .||.|..||.:.|..|          |.|.| |...|:||.|.|.....:|:|
  Fly  2455 QPQDDTNPCAHLGNGGCDQLCFSFPPDGGASGTSGGRNFRCEC-ATGKLSADERKCEVVNEYLVF 2518

Human   939 SQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSR---QNMIRKAQEDGSQGF 1000
            :.::.|..:.:|...:.....|:.:|.||..:|:|....::.:...|   :....||.:.|....
  Fly  2519 ATRTEIRAVNLDPHSTEVPFTPLTNLTNVVGLDFDFAHNRMLYTQIRPWAKIAYTKANKPGHDDI 2583

Human  1001 TVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVN 1065
            |||:      |..|.|..::.|...:.||||..:.|.|....|||..:.::.:.|  ||||:|::
  Fly  2584 TVVL------NKGINPEGIAYDWTQQKIYWTDSSNNSIYAMNLDGSELVMIARVE--RPRAIVLD 2640

Human  1066 PEKGYMYFTNLQE--RSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIES 1128
            |..|.::||:...  .|.||.|..:.|:.:..:....||:|..||:|....:|:|.|:...:||.
  Fly  2641 PCNGTLFFTDWGRFGTSGKIFRTTMAGSLKRAIVDKDLSQPSGLAIDYDERRLYWTDAVREKIER 2705

Human  1129 SDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHA 1193
            |||.|.||.:|..:.| .|..:|||.|::||.|.|.:.:.:.:.  ..|...|: .:.:|.|  :
  Fly  2706 SDLDGQNRELLVAATI-YPFAITVFRNYIYWTDLQLRGVYRAEK--HTGANMVE-MVKRLED--S 2764

Human  1194 VKELNL-----QEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCG-EPPTCSPQ 1252
            .:::.:     |:...:||..:||||:..|....:|...|.|.....::.:...|. ...||...
  Fly  2765 PRDIRIYSSDRQKCNVNPCRINNGGCAQSCHPAPNGKAECKCDDSTKVVNEGRMCAPRNNTCEAS 2829

Human  1253 QFTCFTGEIDCIPVAWRCDGFTECEDHSDE--LNCPV--CSESQFQCASGQCIDGALRCNGDANC 1313
            :|.|..|.  ||...|.|||..:|.|:|||  ..|..  ||.::|:|.:|:||..:.:|:.:.:|
  Fly  2830 KFYCKNGR--CISRMWSCDGDDDCGDNSDEDPNYCAYHSCSPNEFRCNNGRCIFKSWKCDHENDC 2892

Human  1314 QDKSDEKNCEV-LCLIDQFRCANGQCIGKHKKCDHNVDCSDK--SDELDCYPTEEPAPQAT 1371
            :|.|||..|.. .|:..:|.||||:||.:.:.|:...||.|.  |||     |.|..|..|
  Fly  2893 KDGSDELGCVYPPCVDGEFTCANGRCIPQAQVCNGVNDCKDNATSDE-----THERCPMNT 2948

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275 109/260 (42%)
NHL 55..272 CDD:302697 98/221 (44%)
NHL repeat 55..93 CDD:271320 9/38 (24%)
LY 89..127 CDD:214531 18/38 (47%)
NHL repeat 97..132 CDD:271320 19/35 (54%)
NHL repeat 140..176 CDD:271320 20/38 (53%)
Ldl_recept_b 150..190 CDD:278487 27/42 (64%)
LY 175..216 CDD:214531 22/41 (54%)
NHL repeat 181..217 CDD:271320 20/36 (56%)
NHL repeat 226..253 CDD:271320 15/27 (56%)
LDL-receptor class B 5 237..276 13/39 (33%)
FXa_inhibition 286..323 CDD:291342 17/38 (45%)
Beta-propeller 2 328..589 70/286 (24%)
LY 353..393 CDD:214531 10/45 (22%)
LY 397..437 CDD:214531 13/45 (29%)
LY 438..481 CDD:214531 17/51 (33%)
LY 483..524 CDD:214531 11/41 (27%)
LY 525..558 CDD:214531 9/38 (24%)
FXa_inhibition 592..627 CDD:291342 15/36 (42%)
Beta-propeller 3 631..890 84/272 (31%)
LY 656..694 CDD:214531 12/43 (28%)
LY 697..739 CDD:214531 15/46 (33%)
LY 740..783 CDD:214531 18/43 (42%)
LY 783..825 CDD:214531 13/43 (30%)
LY 827..866 CDD:214531 12/40 (30%)
FXa_inhibition 893..929 CDD:291342 17/47 (36%)
Beta-propeller 4 933..1202 78/279 (28%)
LY 958..998 CDD:214531 10/43 (23%)
Ldl_recept_b 1069..1110 CDD:278487 13/43 (30%)
LY 1094..1136 CDD:214531 16/42 (38%)
FXa_inhibition 1207..1243 CDD:291342 9/36 (25%)
LDLa 1249..1285 CDD:238060 15/38 (39%)
LDLa 1288..1322 CDD:238060 13/34 (38%)
LDLa 1326..1360 CDD:238060 15/36 (42%)
PPPSP motif A 1487..1493
PPPSP motif B 1527..1534
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
mglNP_001096924.2 LDLa 157..189 CDD:238060
LDLa 204..236 CDD:238060
LDLa 292..327 CDD:238060
LDLa 332..366 CDD:238060
LDLa 371..412 CDD:238060
vWFA <447..488 CDD:294047
NHL 573..>716 CDD:302697
NHL repeat 573..610 CDD:271320
NHL repeat 616..654 CDD:271320
NHL repeat 657..693 CDD:271320
FXa_inhibition 763..805 CDD:291342
LY 922..964 CDD:214531
LY 973..1007 CDD:214531
Ldl_recept_a 1188..1223 CDD:278486
LDLa 1227..1259 CDD:197566
LDLa 1268..1303 CDD:238060
LDLa 1308..1343 CDD:238060
LDLa 1356..1387 CDD:238060
LDLa 1391..1423 CDD:197566
LDLa 1435..1469 CDD:197566
FXa_inhibition 1478..1513 CDD:291342
FXa_inhibition 1522..1553 CDD:291342
LY 1625..1665 CDD:214531 19/40 (48%)
LY 1667..1711 CDD:214531 22/44 (50%)
Ldl_recept_b 1690..1728 CDD:278487 26/38 (68%)
LY 1712..1754 CDD:214531 22/42 (52%)
LY 1986..2037 CDD:214531 18/51 (35%)
FXa_inhibition 2151..>2179 CDD:291342 15/28 (54%)
LY 2259..2305 CDD:214531 15/46 (33%)
Ldl_recept_b 2326..2366 CDD:278487 15/40 (38%)
LY 2352..2392 CDD:214531 12/40 (30%)
NHL 2579..>2711 CDD:302697 47/140 (34%)
NHL repeat 2593..2622 CDD:271320 10/29 (34%)
NHL repeat 2634..2678 CDD:271320 13/44 (30%)
LY 2671..2713 CDD:214531 16/42 (38%)
LDLa 2867..2901 CDD:238060 13/34 (38%)
LDLa 2906..2941 CDD:238060 16/40 (40%)
LDLa 2950..2983 CDD:238060
LDLa 3034..3066 CDD:197566
LDLa 3080..3115 CDD:197566
LDLa 3128..3159 CDD:238060
LDLa 3170..3204 CDD:238060
LDLa 3210..3242 CDD:197566
cEGF 3269..3292 CDD:289433
vWFA <3284..3324 CDD:294047
LY 3362..3394 CDD:214531
LY 3406..3448 CDD:214531
LY 3498..3536 CDD:214531
LY 3536..3578 CDD:214531
FXa_inhibition 3607..3659 CDD:291342
LDLa 3663..3696 CDD:238060
LDLa 3705..3739 CDD:238060
LDLa 3743..3775 CDD:197566
LDLa 3784..3817 CDD:197566
LDLa 3827..3861 CDD:197566
LDLa 3871..3901 CDD:197566
LDLa 3913..3947 CDD:238060
LDLa 3952..3986 CDD:238060
LDLa 3996..4027 CDD:197566
LDLa 4043..4071 CDD:238060
LDLa 4086..4117 CDD:238060
EGF_CA 4163..4194 CDD:214542
NHL 4276..>4426 CDD:302697
NHL repeat 4291..4336 CDD:271320
Ldl_recept_b 4350..4390 CDD:278487
NHL repeat 4376..4422 CDD:271320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.