DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and ImpE1

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_001261577.1 Gene:ImpE1 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster

Alignment Length:188 Identity:58/189 (31%)
Similarity:78/189 (41%) Gaps:46/189 (24%)


Human  1184 RIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPT 1248
            |..||:|.|.|            |.: .|.|.  | ..|:..::||              .|...
  Fly  1369 RQCQLADPHTV------------CNR-RGVCD--C-AAGEEGSQCS--------------AERTG 1403

Human  1249 CSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDE-------LNCPVCSESQFQC-ASGQCIDGAL 1305
            |||..|.|.:..: ||...:.|||..:|.|.|||       || ..|....|:| .||:||..|.
  Fly  1404 CSPGTFQCRSSGV-CISWFFVCDGRADCNDASDEECTHNARLN-QTCPTESFRCQRSGRCISRAA 1466

Human  1306 RCNGDANCQDKSDEKNCE------VLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDE 1357
            .|:|...|....||..|:      ..|....|||.:|:|:.:::.|:..|.|.|.|||
  Fly  1467 LCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKDGSDE 1524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275
NHL 55..272 CDD:302697
NHL repeat 55..93 CDD:271320
LY 89..127 CDD:214531
NHL repeat 97..132 CDD:271320
NHL repeat 140..176 CDD:271320
Ldl_recept_b 150..190 CDD:278487
LY 175..216 CDD:214531
NHL repeat 181..217 CDD:271320
NHL repeat 226..253 CDD:271320
LDL-receptor class B 5 237..276
FXa_inhibition 286..323 CDD:291342
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342
Beta-propeller 3 631..890
LY 656..694 CDD:214531
LY 697..739 CDD:214531
LY 740..783 CDD:214531
LY 783..825 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:291342
Beta-propeller 4 933..1202 6/18 (33%)
LY 958..998 CDD:214531
Ldl_recept_b 1069..1110 CDD:278487
LY 1094..1136 CDD:214531
FXa_inhibition 1207..1243 CDD:291342 7/36 (19%)
LDLa 1249..1285 CDD:238060 17/43 (40%)
LDLa 1288..1322 CDD:238060 13/35 (37%)
LDLa 1326..1360 CDD:238060 13/33 (39%)
PPPSP motif A 1487..1493
PPPSP motif B 1527..1534
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
ImpE1NP_001261577.1 EB 75..131 CDD:279949
LDLa 1404..1437 CDD:238060 15/34 (44%)
LDLa 1448..1483 CDD:238060 13/35 (37%)
LDLa 1493..1524 CDD:238060 12/31 (39%)
LDLa 1561..1590 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.