DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and arr

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_524737.2 Gene:arr FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster

Alignment Length:1658 Identity:715/1659 (43%)
Similarity:997/1659 (60%) Gaps:139/1659 (8%)


Human    23 LLYANRRDLRLVDAT--NGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKT-- 83
            ||:..|.|:::.:.|  .|.....::|..|.:|.|:||.::..|:.|:|...|.|:..:.|.:  
  Fly    89 LLFTTRHDIQVANITRPTGGPQIDVIVRDLAEAMAIDFYYAKNLVCWTDSGREIIECAQTNSSAL 153

Human    84 -----ESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAI 143
                 ...|.|:.:||..|:|||.||..:|:||||.|.|||||:.|||..:|||||.:||||||:
  Fly   154 QPLLRAPKQTVISTGLDKPEGLAMDWYTDKIYWTDGEKNRIEVATLDGRYQKVLFWTDLDQPRAV 218

Human   144 ALDPSSGFMYWTDWGEVPKIERAGMDGS--SRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFI 206
            |:.|:...:.||||||.||||||.|||.  ||..::...::|||||.:|.:.:.:||.|.|.:||
  Fly   219 AVVPARKLLIWTDWGEYPKIERASMDGDPLSRMTLVKEHVFWPNGLAVDLKNELIYWTDGKHHFI 283

Human   207 HKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDI 271
            ....|||::|:.:| .:|.:||:||.::|.||||||...|:.|.:..|.| |:|:.....:|..:
  Fly   284 DVMRLDGSSRRTIV-NNLKYPFSLTFYDDRLYWTDWQRGSLNALDLQTRE-LKELIDTPKAPNSV 346

Human   272 HAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARR 336
            .|:....||...|||..:||.||||||::.....:.|||||||||: :..||.:|:.|::.:.:|
  Fly   347 RAWDPSLQPYEDNPCAHNNGNCSHLCLLATNSQGFSCACPTGVKLI-SANTCANGSQEMMFIVQR 410

Human   337 TDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQ 401
            |.:.:||||:||:|...|.|..:::||||||||||.:|||:|.|...|:|:..||:|....||::
  Fly   411 TQISKISLDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHADGTGVTDFVTSE 475

Human   402 IAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWG 466
            :.||||:|:||:|||||||||.||||||.||:||.||:||.|.|||||||.:.|.:|:|:|:||.
  Fly   476 VRHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWN 540

Human   467 E-IPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVED 530
            | .||:|||:||||:|||||:.:||||||:|||.:...|||.|.|||||||.|.||:||||::.|
  Fly   541 ERKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVISD 605

Human   531 KIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSA-EREVIIDQLPDLMGLKATNVHRVIGSNPCAE 594
            .:.|:||.::|.||:||||||||||:|.||.:. .|.|::||.|||||||.|.:..|.|.|.||.
  Fly   606 NLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMGLKVTRLREVRGQNACAV 670

Human   595 ENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISL---ETNNNNVAI 656
            .|||||||||.||:...|.|.|.:||.:|.:||:||.|||||||:..|.|||:   |.|:|:..|
  Fly   671 RNGGCSHLCLNRPRDYVCRCAIDYELANDKRTCVVPAAFLLFSRQEHIGRISIEYNEGNHNDERI 735

Human   657 PLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYW 721
            |...|::|.|||..|.:.||||||...|.|.|||:|||.::.:|:.||..|:|:|||||..|:||
  Fly   736 PFKDVRDAHALDVSVAERRIYWTDQKSKCIFRAFLNGSYVQRIVDSGLIGPDGIAVDWLANNIYW 800

Human   722 ADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTL 786
            :|....||||::|||..|:||:||.::.||:|.|:|..|:||||| .....|.|||||||:..|:
  Fly   801 SDAEARRIEVARLDGSSRRVLLWKGVEEPRSLVLEPRRGYMYWTE-SPTDSIRRAAMDGSDLQTI 864

Human   787 VPNVGRANGLTIDYAKRRLYW-TDLDTNLIESSNMLGLNREV-IADDLPHPFGLTQYQDYIYWTD 849
            |.....|.|||.|...||||| |......|||::..|..|:: :..|:..|:.::.||||:||:|
  Fly   865 VAGANHAAGLTFDQETRRLYWATQSRPAKIESADWDGKKRQILVGSDMDEPYAVSLYQDYVYWSD 929

Human   850 WSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVG--GF 912
            |:...|||.:||:||||:::...:.|:..:|||:..||:|.|.|..:||.|||||||.| |  |.
  Fly   930 WNTGDIERVHKTTGQNRSLVHSGMTYITSLLVFNDKRQTGVNPCKVNNGGCSHLCLAQP-GRRGM 993

Human   913 VCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDK 977
            .|.||.||.|..|..:|..|..:::|||::...|::.:....|:|.||: |.:|:||:||||:..
  Fly   994 TCACPTHYQLAKDGVSCIPPRNYIIFSQRNCFGRLLPNTTDCPNIPLPV-SGKNIRAVDYDPITH 1057

Human   978 QLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTR 1042
            .:|||:.|.:.|:::..:|::     ||.:.:..   ||:||:|||..|.::|||..:|.||||.
  Fly  1058 HIYWIEGRSHSIKRSLANGTK-----VSLLANSG---QPFDLAIDIIGRLLFWTCSQSNSINVTS 1114

Human  1043 LDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIAL 1107
            ..|.||||:..|:.::||.:.|:..|..:::|::.... .|.||.:||.||..|.:. |....||
  Fly  1115 FLGESVGVIDTGDSEKPRNIAVHAMKRLLFWTDVGSHQ-AIIRARVDGNERVELAYK-LEGVTAL 1177

Human  1108 ALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDM 1172
            |||.:...:::|..  :||::.|::|.|:..|...:|.|.:.:.....::||:| .:..:|:|.:
  Fly  1178 ALDQQSDMIYYAHG--KRIDAIDINGKNKKTLVSMHISQVINIAALGGFVYWLD-DKTGVERITV 1239

Human  1173 TGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTR----CSCPMH 1233
            .|.....::| |:.|::||.||...:.:..|.|.|......|||||:..|:|..|    ||||.|
  Fly  1240 NGERRSAELQ-RLPQITDIRAVWTPDPKVLRNHTCMHSRTKCSHICIASGEGIARTRDVCSCPKH 1303

Human  1234 LVLLQDELSCGEPPTCSPQQFTC---FTG----EIDCIPVAWRCDGFTECEDHSDELNCPVCSES 1291
            |:||:|:.:||..|.|.|..|||   .:|    ..||||.:|||||..:|.|.|||:.||.|...
  Fly  1304 LMLLEDKENCGAFPACGPDHFTCAAPVSGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRAD 1368

Human  1292 QFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLC-LIDQFRC-ANGQCIGKHKKCDHNVDCSDK 1354
            ||.|.||:|||.:|.|:|..||.:..||.:|   | ...:|:| .|..||.....||...:|:|.
  Fly  1369 QFSCQSGECIDKSLVCDGTTNCANGHDEADC---CKRPGEFQCPINKLCISAALLCDGWENCADG 1430

Human  1355 SDELDCYPTEEPAPQATNTVGSVI---GVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVH 1416
            :||......:.....||:....:|   ..::|||  ..||.:   ..|....|...|...|....
  Fly  1431 ADESSDICLQRRMAPATDKRAFMILIGATMITIF--SIVYLL---QFCRTRIGKSRTEPKDDQAT 1490

Human  1417 GPASVPLGYVPHPSSLSGSLPGMSRGKSMISSL-------SIMGGSSGPPYDRAHVTGASSSSSS 1474
            .|.|        ||:||     .|:..|.|:|:       ::...:|...|||.|:||||||:::
  Fly  1491 DPLS--------PSTLS-----KSQRVSKIASVADAVRMSTLNSRNSMNSYDRNHITGASSSTTN 1542

Human  1475 STKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHF-----APPTTPCST 1534
            .:....:|  :||||||||.                     |.||  |||:     .||.|||||
  Fly  1543 GSSMVAYP--INPPPSPATR---------------------SRRP--YRHYKIINQPPPPTPCST 1582

Human  1535 DVC---DSDY------------APSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLS----A 1580
            |:|   ||:|            |.....:|.|....|    .|||||.||||||||.|.|    .
  Fly  1583 DICDESDSNYTSKSNSNNSNGGATKHSSSSAAACLQY----GYDSEPYPPPPTPRSHYHSDVRIV 1643

Human  1581 EENYESCPPSPYTERSYSHHLYPPPPSPCTDSS 1613
            .|:  ||||||.:..|......||||||....|
  Fly  1644 PES--SCPPSPSSRSSTYFSPLPPPPSPVQSPS 1674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275 109/263 (41%)
NHL 55..272 CDD:302697 99/226 (44%)
NHL repeat 55..93 CDD:271320 11/45 (24%)
LY 89..127 CDD:214531 23/38 (61%)
NHL repeat 97..132 CDD:271320 22/35 (63%)
NHL repeat 140..176 CDD:271320 22/38 (58%)
Ldl_recept_b 150..190 CDD:278487 22/42 (52%)
LY 175..216 CDD:214531 15/41 (37%)
NHL repeat 181..217 CDD:271320 16/36 (44%)
NHL repeat 226..253 CDD:271320 13/27 (48%)
LDL-receptor class B 5 237..276 14/39 (36%)
FXa_inhibition 286..323 CDD:291342 19/37 (51%)
Beta-propeller 2 328..589 154/263 (59%)
LY 353..393 CDD:214531 21/40 (53%)
LY 397..437 CDD:214531 28/40 (70%)
LY 438..481 CDD:214531 27/44 (61%)
LY 483..524 CDD:214531 27/41 (66%)
LY 525..558 CDD:214531 20/33 (61%)
FXa_inhibition 592..627 CDD:291342 20/35 (57%)
Beta-propeller 3 631..890 125/264 (47%)
LY 656..694 CDD:214531 21/38 (55%)
LY 697..739 CDD:214531 21/42 (50%)
LY 740..783 CDD:214531 23/43 (53%)
LY 783..825 CDD:214531 17/43 (40%)
LY 827..866 CDD:214531 18/40 (45%)
FXa_inhibition 893..929 CDD:291342 20/38 (53%)
Beta-propeller 4 933..1202 87/269 (32%)
LY 958..998 CDD:214531 16/40 (40%)
Ldl_recept_b 1069..1110 CDD:278487 14/41 (34%)
LY 1094..1136 CDD:214531 13/42 (31%)
FXa_inhibition 1207..1243 CDD:291342 18/40 (45%)
LDLa 1249..1285 CDD:238060 20/43 (47%)
LDLa 1288..1322 CDD:238060 16/34 (47%)
LDLa 1326..1360 CDD:238060 12/36 (33%)
PPPSP motif A 1487..1493 6/6 (100%)
PPPSP motif B 1527..1534 6/7 (86%)
PPPSP motif C 1568..1575 7/7 (100%)
PPPSP motif D 1588..1593 4/5 (80%)
PPPSP motif E 1603..1610 6/7 (86%)
arrNP_524737.2 LY 162..201 CDD:214531 23/39 (59%)
NHL 168..503 CDD:302697 169/338 (50%)
NHL repeat 172..237 CDD:271320 40/65 (62%)
LY 252..293 CDD:214531 15/41 (37%)
NHL repeat 261..298 CDD:271320 16/38 (42%)
NHL repeat 303..339 CDD:271320 17/37 (46%)
NHL repeat 341..419 CDD:271320 33/79 (42%)
NHL repeat 428..476 CDD:271320 24/48 (50%)
LY 472..511 CDD:214531 28/39 (72%)
NHL repeat 477..503 CDD:271320 21/26 (81%)
Ldl_recept_b 534..573 CDD:278487 27/39 (69%)
LY 558..599 CDD:214531 27/41 (66%)
LY 600..641 CDD:214531 22/41 (54%)
FXa_inhibition 668..703 CDD:291342 20/35 (57%)
LY 739..773 CDD:214531 19/34 (56%)
LY 776..818 CDD:214531 21/42 (50%)
LY 819..860 CDD:214531 23/42 (55%)
FXa_inhibition 973..1010 CDD:291342 20/38 (53%)
LY 1122..1164 CDD:214531 13/43 (30%)
FXa_inhibition 1273..1313 CDD:291342 18/40 (45%)
LDLa 1319..1362 CDD:238060 20/43 (47%)
LDLa 1365..1399 CDD:238060 16/34 (47%)
LDLa 1399..1433 CDD:197566 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102609536
eggNOG 1 0.900 E1_KOG1215
Hieranoid 1 1.000
Homologene 1 1.000 H1747
Inparanoid 1 1.050 1329 1.000 Inparanoid score I144
Isobase 1 0.950 0 Normalized mean entropy S5302
OMA 1 1.010
OrthoDB 1 1.010 D121310at2759
OrthoFinder 1 1.000 FOG0002706
OrthoInspector 1 1.000 T608439
orthoMCL 1 0.900 OOG5_126933
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.963 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.620

Return to query results.
Submit another query.