DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and CG32432

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_649266.1 Gene:CG32432 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster

Alignment Length:316 Identity:63/317 (20%)
Similarity:93/317 (29%) Gaps:122/317 (38%)


Human  1326 CLIDQFRCANGQCIGKHKKCDHNVDCSDKSDE--------------------LDCY-PTEEPAP- 1368
            |.:.:|.|:||:|:...|.|::..||.|.|||                    |:.: |.::..| 
  Fly   214 CSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALELHRPKQDRVPF 278

Human  1369 -------QATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYV 1426
                   .|....|.|:.|.:..|..|..                    ..||..|   .|.||:
  Fly   279 VCVLTFTAAGGQHGDVVQVTLDSFTIGRF--------------------TSYVHEG---CPDGYM 320

Human  1427 PHPSSLSGSLPGM------------SRGKSMISSL---SIMGGSSGPPYD---RAHVTGASSS-- 1471
            ....|....:.||            |..:|:|.::   .:....||..:|   |..|....||  
  Fly   321 QIAESARTPIGGMWCGSSWGPVLFYSETRSLIFTIRLNRLARDQSGYNFDFRIRYKVLSRDSSVT 385

Human  1472 --------------------------------SSSSTKGTYFPAILNPPPSPATERS-HYTMEF- 1502
                                            .....:|.  |.||....:.:..|| .|..:| 
  Fly   386 RYGGIKLAELAQWHNRSSFLNQQQQQQQQQQQQQQQQQGA--PGILEDFTNSSVARSDRYGQDFS 448

Human  1503 ---GYSSNS----------PSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSR 1545
               .|::|.          ....::|: .|..|.....|.|.||....|.|..|.|
  Fly   449 LFSAYANNKTFMASLEKSLAKDEQNYT-EPKYYLGDLIPGTYCSRIFSDCDKKPCR 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275
NHL 55..272 CDD:302697
NHL repeat 55..93 CDD:271320
LY 89..127 CDD:214531
NHL repeat 97..132 CDD:271320
NHL repeat 140..176 CDD:271320
Ldl_recept_b 150..190 CDD:278487
LY 175..216 CDD:214531
NHL repeat 181..217 CDD:271320
NHL repeat 226..253 CDD:271320
LDL-receptor class B 5 237..276
FXa_inhibition 286..323 CDD:291342
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342
Beta-propeller 3 631..890
LY 656..694 CDD:214531
LY 697..739 CDD:214531
LY 740..783 CDD:214531
LY 783..825 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:291342
Beta-propeller 4 933..1202
LY 958..998 CDD:214531
Ldl_recept_b 1069..1110 CDD:278487
LY 1094..1136 CDD:214531
FXa_inhibition 1207..1243 CDD:291342
LDLa 1249..1285 CDD:238060
LDLa 1288..1322 CDD:238060
LDLa 1326..1360 CDD:238060 15/54 (28%)
PPPSP motif A 1487..1493 0/6 (0%)
PPPSP motif B 1527..1534 4/7 (57%)
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
CG32432NP_649266.1 LDLa 214..245 CDD:197566 13/31 (42%)
CUB 503..646 CDD:238001 1/2 (50%)
LDLa 1203..1231 CDD:197566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.