DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and cue

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_612113.2 Gene:cue FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster

Alignment Length:264 Identity:80/265 (30%)
Similarity:126/265 (48%) Gaps:39/265 (15%)


Human    15 VLLRAAPLLLYAN------------RRDLRLVD------ATNGKENATIVVGGLEDAAAVDFVFS 61
            |||.|..||..|:            |..::.:|      ||...|        .::.:|:.|..|
  Fly    13 VLLLATCLLTPAHGTPLEWDFAVTLRTKIQFMDSSWQTIATAAHE--------FDELSALTFDES 69

Human    62 HGLIYWSDVSEE-----AIKRTEFNKTE-SVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE 120
            ..|||::|:...     ::||....... :.|.:..:|..|..|||.|.|...|:|:|:|..:|.
  Fly    70 EELIYFNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGNESVGGLAYDPLNMNLFWSDTEQRKIF 134

Human   121 VSNLDGSLR-KVL--FWQELDQPRAIALDPSSGFMYWTDWGEV-PKIERAGMDGSSRFIIINSEI 181
            .:.:.||.. :||  ...|..:|..:|:|.....:|||:.... |.:||..:|||:|.:||:|.|
  Fly   135 FAPIHGSATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPTVERINLDGSNRTVIISSNI 199

Human   182 YWPNGLTLDYEEQKLYWA-DAKLNF--IHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWS 243
            ..|.|:.:|....:|:|. |.|..|  :..|.|||::||.|:|.....|..|.:..|.:||||.:
  Fly   200 DMPRGIVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVVLKDKHHEPLNLAVTNDAIYWTDRT 264

Human   244 THSI 247
            |.::
  Fly   265 TRAV 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275 76/260 (29%)
NHL 55..272 CDD:302697 68/207 (33%)
NHL repeat 55..93 CDD:271320 10/44 (23%)
LY 89..127 CDD:214531 13/38 (34%)
NHL repeat 97..132 CDD:271320 13/36 (36%)
NHL repeat 140..176 CDD:271320 13/37 (35%)
Ldl_recept_b 150..190 CDD:278487 16/41 (39%)
LY 175..216 CDD:214531 16/44 (36%)
NHL repeat 181..217 CDD:271320 14/39 (36%)
NHL repeat 226..253 CDD:271320 8/23 (35%)
LDL-receptor class B 5 237..276 5/12 (42%)
FXa_inhibition 286..323 CDD:291342
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342
Beta-propeller 3 631..890
LY 656..694 CDD:214531
LY 697..739 CDD:214531
LY 740..783 CDD:214531
LY 783..825 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:291342
Beta-propeller 4 933..1202
LY 958..998 CDD:214531
Ldl_recept_b 1069..1110 CDD:278487
LY 1094..1136 CDD:214531
FXa_inhibition 1207..1243 CDD:291342
LDLa 1249..1285 CDD:238060
LDLa 1288..1322 CDD:238060
LDLa 1326..1360 CDD:238060
PPPSP motif A 1487..1493
PPPSP motif B 1527..1534
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
cueNP_612113.2 LY 101..141 CDD:214531 14/40 (35%)
Ldl_recept_b 167..208 CDD:278487 16/41 (39%)
LY 193..237 CDD:214531 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.