DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and LRP1

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_001260800.2 Gene:LRP1 FlyBaseID:FBgn0053087 Length:4752 Species:Drosophila melanogaster

Alignment Length:1755 Identity:516/1756 (29%)
Similarity:783/1756 (45%) Gaps:328/1756 (19%)


Human    21 PLLLYANRRDLRLVDATNGKENATIVVG----GLEDAAAVDFVF---SHGLIYWSDVSEEAIKRT 78
            |.:::.||:|::      |....|:.||    .|.:..|:||::   |:..|||:||.::.|.|.
  Fly  1365 PYVIFTNRQDIK------GINLKTLNVGNFYSSLRNIIALDFLYNNESNVEIYWTDVIDDKIYRG 1423

Human    79 EF--NKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPR 141
            ..  ....:|:.|:.|||.:.:|||.||:|:.|||.||..::|||:.|:||.|:.|....::.||
  Fly  1424 HLVGESLRNVEAVIHSGLSTTEGLAVDWVGKNLYWIDSNLDQIEVAKLNGSFRRTLIAGNMESPR 1488

Human   142 AIALDPSSGFMYWTDWGE-VPKIERAGMDGSSRFIIINS---EIYWPNGLTLDYEEQKLYWADAK 202
            ||||||..|.::||||.: .|:||||.|.|..|.:|..|   ...|||||||||.::::||.|||
  Fly  1489 AIALDPREGLLFWTDWDDNSPRIERASMSGDGRRMISTSWQLSAGWPNGLTLDYTQKRVYWVDAK 1553

Human   203 LNFIHKSNLDGTNRQAVVKGS--LPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDI 265
            .:.|..:..||:....|::..  |.||||:::||:.:|||||.|.|::..||:.|..::.:....
  Fly  1554 SDSISSTMYDGSEHHVVLRNKEILSHPFAISVFENYVYWTDWRTTSVIRANKWNGSDVQVLQRTQ 1618

Human   266 FSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKL-LENGKTCKDGATE 329
            ..|..|......|||...||||.:|||||||||:|. :..::|.||..::| ..|.:.|... .:
  Fly  1619 SQPFGIQVLHSSRQPWDRNPCGENNGGCSHLCLLSG-RGTFKCECPHVMRLDPANERNCVPN-EQ 1681

Human   330 LLLLARRTDLRRISLDTPDFTDI--VLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGS 392
            :||.....::|.|.|..|:...|  :.|...:.....||:...|..|:|:|.:...|..:.|...
  Fly  1682 VLLFVMVDEIRGIDLHQPNHHTIPTIRQSPRLVAPQRIDFLVDESRIFWSDIQQNEISSAGISNG 1746

Human   393 GSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEV--TRLNGTMRKILISEDLEEPRAIVLDP 455
            ..:.::...|..|.|.||||:|||:|:: :|..:..:  :.|.|....| |.|||....:|||||
  Fly  1747 LIEPIINTNIEKPYGFAVDWIARNMYFS-SGQIKCNILASNLKGEFASI-IHEDLNMVDSIVLDP 1809

Human   456 MVGYMYW----TDWGEIPKIERAALDGSDRVVLV--NTSLGWPNGLALDYDEGKIYWGDAKTDKI 514
            ..|.|||    :| |.:.::|::.||||.|.::.  ..:|   ..|.:|:|..::|:.       
  Fly  1810 ANGKMYWIHSASD-GSMSQLEQSNLDGSSRSLIYQHENNL---QSLTMDFDSQRLYYA------- 1863

Human   515 EVMNTDGTG-----------RRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRS-AEREV 567
                .|.:|           |:|||...|..|...|:....:|:.:..:..|.:..|.: :....
  Fly  1864 ----YDNSGIAYYDIPRNETRKVLVASPITSISSLTVYNGTLYFPENIQSVIMQCEKEACSNMSY 1924

Human   568 IIDQLPDLMGLKATNVHRVIGSNPCAE--ENGGCSHLCLYRPQ-GLRCACPIGFELISDMKTCIV 629
            :......:..:|........|||.|||  ..|||..|||.... ...|.|.:|:::..:..|..|
  Fly  1925 LRVNTKSIQSMKMFYADAQTGSNTCAEWAYRGGCQQLCLATSSIDHVCRCALGYDVEPNNPTGCV 1989

Human   630 PEAFLLF--------------SRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTD 680
            |.|..:|              |.:.|....:|        :|::.|..||.:|:....:.:||.|
  Fly  1990 PRAEFIFYSIDVLQGVEMIDPSEQFDTPSPAL--------VPISRVSSASFIDYLANTDTLYWGD 2046

Human   681 ISLKTISRAFMNGSALEHVVE----FGL---DYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQH 738
            ..|.:|||...:|:..|.::|    .|.   |:..|:|:||:..|:||:||..|.|||::|||.|
  Fly  2047 NELGSISRVKRDGTQRETILEALNLVGYKQQDWLGGIAIDWVAGNIYWSDTKRNIIEVARLDGSH 2111

Human   739 RQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRAN----GLTID 799
            |.|:| .:|:.|.|||:||.:|.:::..   :..|.|..:|||:...|| |..|||    .|.:|
  Fly  2112 RYVVV-SNLEKPTALAVDPLQGLLFYVT---QQHIGRVGLDGSQPFVLV-NQTRANWAVGSLVLD 2171

Human   800 YAKRRLYW----------TDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTD--WSR 852
            ....::||          .|.|.||.|         :::.:.|.:|..|.:..||:||.:  ::.
  Fly  2172 IEATKVYWCERYPDALMKVDYDGNLRE---------QLLNESLNNPVALAKMGDYLYWAENKYNE 2227

Human   853 RSIERANKTS-GQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGC 916
            ..|..|...: .|::.::|...|.:.|:.::....|.|.|.||.|||.|..|||...... ||.|
  Fly  2228 GIIRVAPLANLSQSKVVLQTEQDAIRDLKIYSKHLQRGSNPCAHSNGACEQLCLFNGTSA-VCAC 2291

Human   917 PAHYSLNADNRTCSAPTTFLLFSQKSAINRMVI----DEQQSPDIILPIHSLRNVRAIDYDPLDK 977
             ||..|.:|..:|.....|||||.:|.|..:.:    |:.....:|.....:|||.||.|:..::
  Fly  2292 -AHSRLASDGYSCEPYENFLLFSYRSNIESIHMTDHADKNWPVQMISNTSLMRNVIAITYNYEEQ 2355

Human   978 QLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTR 1042
            .:|:.|.:.:.|.:...:|: |..|::..  .|.:|    .|:.||.:..::||......|....
  Fly  2356 LVYYSDVQLSTINQVHFNGT-GHRVLLEQ--QQRVE----GLAYDIVNEQLFWTSNNNATIRSVE 2413

Human  1043 L-------DGRSVGV--VLK-GEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLF 1097
            |       |...|.|  ||. .|.|:||.:.|.|..|.:|:||..|.||.|:|:.|.|...||:.
  Fly  2414 LRHLSEHADQNQVHVKKVLSLREDDKPRGIAVEPCLGMIYWTNWNEGSPCIQRSYLTGYGTEVII 2478

Human  1098 FSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDK 1162
            .:.:..|.||.||....||:|||:.|.:||.::..|:||:||..|.......:.|:.:.|:|.|.
  Fly  2479 KTDIKMPNALTLDLEQQKLYWADARLDKIERTNYDGSNRVVLAHSTPKHAFAMAVYGDLLFWTDW 2543

Human  1163 QQQMIEKID-MTG------REGRTKVQARIA-QLSDIHAVKELNLQEYRQHPCAQDNGGCSHICL 1219
            ....:.:.: .||      ||..|:....:| |.:.|:.         ..:.|...||.|..:|:
  Fly  2544 VLHAVVRANKYTGTDVLFLREHVTRPMGIVAVQNTSINC---------DANQCKILNGQCEDVCI 2599

Human  1220 VKGDGTTRCSCPMHLVLLQDELSCGEP--PTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDE 1282
            :...|...|.|... ||..|...|..|  .:|...|:.|.:||  |||:...||..|.|.|.|||
  Fly  2600 LNKSGQATCHCTQG-VLAPDGRRCIAPVNTSCGLSQYNCHSGE--CIPLELTCDNVTHCADGSDE 2661

Human  1283 LN--C--PVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLC----------------- 1326
            ..  |  ..|.|:.|.|.:.:||....:|:|:..|.|.|||  ..:||                 
  Fly  2662 FRSYCIFRQCPETHFMCQNHRCIPKEHKCDGEQQCGDGSDE--TPLLCKCQSEDIDMHPSNNNTK 2724

Human  1327 -LIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTV 1390
             :.|.|||.:|:||.:...||...||.|.|||..|    .|.|...|.:         .||....
  Fly  2725 EMPDMFRCGSGECIPRKFLCDSLKDCRDFSDEKMC----APIPCEKNDM---------TFVHCGN 2776

Human  1391 YFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSR---GKSMISSLSIM 1452
            ..||   :.||.:.||:....|      .:..|....| :|||.. ||..|   |..:..|....
  Fly  2777 STIC---IMPRWRCDGDPDCPD------GTDELDCANH-TSLSCD-PGQFRCASGNCIAGSWHCD 2830

Human  1453 GGSSGP-----------------PYDRAHV------TGASSSSSSSTKGTYFPAILNPPPSPATE 1494
            |....|                 ..|:..:      .|.|.....|.:|...|            
  Fly  2831 GEKDCPDGSDEINCRTECRHNQFACDKTCIPASWQCDGKSDCEDGSDEGPQCP------------ 2883

Human  1495 RSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTD--------VCDSDY-APSRRMTSV 1550
                        |.|.       ||:.::        |.:.        |||.:. .||      
  Fly  2884 ------------NRPC-------RPHLFQ--------CKSSGRCIPQKWVCDGEKDCPS------ 2915

Human  1551 ATAKGYTSDLNYDSEP-------VPPPPTPR----------SQYL--------SAEENYESCPPS 1590
                |...:.:.|..|       :|..|.|.          |.|:        ..::.||.|.|:
  Fly  2916 ----GLGDEGSEDEGPQCGGVAHIPDCPPPAHLCTSGLCIDSHYVCDGDEDCPGGDDEYEGCVPA 2976

Human  1591  1590
              Fly  2977  2976

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275 104/269 (39%)
NHL 55..272 CDD:302697 95/228 (42%)
NHL repeat 55..93 CDD:271320 14/43 (33%)
LY 89..127 CDD:214531 20/38 (53%)
NHL repeat 97..132 CDD:271320 18/35 (51%)
NHL repeat 140..176 CDD:271320 21/37 (57%)
Ldl_recept_b 150..190 CDD:278487 22/44 (50%)
LY 175..216 CDD:214531 19/44 (43%)
NHL repeat 181..217 CDD:271320 17/36 (47%)
NHL repeat 226..253 CDD:271320 15/27 (56%)
LDL-receptor class B 5 237..276 12/39 (31%)
FXa_inhibition 286..323 CDD:291342 17/38 (45%)
Beta-propeller 2 328..589 71/283 (25%)
LY 353..393 CDD:214531 9/40 (23%)
LY 397..437 CDD:214531 14/42 (33%)
LY 438..481 CDD:214531 21/47 (45%)
LY 483..524 CDD:214531 7/54 (13%)
LY 525..558 CDD:214531 8/33 (24%)
FXa_inhibition 592..627 CDD:291342 13/38 (34%)
Beta-propeller 3 631..890 85/297 (29%)
LY 656..694 CDD:214531 13/38 (34%)
LY 697..739 CDD:214531 21/49 (43%)
LY 740..783 CDD:214531 15/43 (35%)
LY 783..825 CDD:214531 15/56 (27%)
LY 827..866 CDD:214531 10/42 (24%)
FXa_inhibition 893..929 CDD:291342 16/36 (44%)
Beta-propeller 4 933..1202 85/291 (29%)
LY 958..998 CDD:214531 11/40 (28%)
Ldl_recept_b 1069..1110 CDD:278487 17/41 (41%)
LY 1094..1136 CDD:214531 17/42 (40%)
FXa_inhibition 1207..1243 CDD:291342 11/36 (31%)
LDLa 1249..1285 CDD:238060 16/38 (42%)
LDLa 1288..1322 CDD:238060 13/34 (38%)
LDLa 1326..1360 CDD:238060 16/52 (31%)
PPPSP motif A 1487..1493 0/6 (0%)
PPPSP motif B 1527..1534 1/7 (14%)
PPPSP motif C 1568..1575 3/17 (18%)
PPPSP motif D 1588..1593 1/4 (25%)
PPPSP motif E 1603..1610
LRP1NP_001260800.2 LDLa 87..118 CDD:197566
LDLa 126..163 CDD:238060
EGF_CA 246..283 CDD:214542
Ldl_recept_b 449..487 CDD:278487
LY 472..513 CDD:214531
LY 817..852 CDD:214531
LDLa 1057..1092 CDD:197566
LDLa 1104..1134 CDD:238060
FXa_inhibition 1289..1317 CDD:291342
LY 1434..1476 CDD:214531 21/42 (50%)
LY 1477..1521 CDD:214531 21/44 (48%)
LY 1533..1567 CDD:214531 17/34 (50%)
LY 1568..1611 CDD:214531 18/43 (42%)
FXa_inhibition 1639..1676 CDD:291342 17/38 (45%)
LY 1794..1838 CDD:214531 21/46 (46%)
LY 2078..2112 CDD:214531 18/34 (53%)
NHL <2082..>2152 CDD:302697 33/74 (45%)
NHL repeat 2082..2120 CDD:271320 21/39 (54%)
FXa_inhibition 2269..2303 CDD:291342 16/36 (44%)
LY 2430..2471 CDD:214531 18/41 (44%)
LY 2475..2517 CDD:214531 17/42 (40%)
LDLa 2630..2661 CDD:238060 15/33 (45%)
LDLa 2671..2702 CDD:238060 12/31 (39%)
LDLa 2727..2759 CDD:238060 15/32 (47%)
LDLa 2773..2802 CDD:238060 8/38 (21%)
LDLa 2810..2844 CDD:238060 7/35 (20%)
LDLa 2848..2878 CDD:238060 4/30 (13%)
LDLa 2887..2916 CDD:197566 8/54 (15%)
LDLa 2938..2969 CDD:197566 4/31 (13%)
LDLa 2989..3015 CDD:197566
LDLa 3030..3061 CDD:238060
EGF_CA 3062..>3091 CDD:214542
EGF_CA 3103..3141 CDD:214542
LY 3212..3254 CDD:214531
LY 3255..3297 CDD:214531
LY 3299..3340 CDD:214531
LY 3354..3389 CDD:214531
LDLa 3458..3490 CDD:238060
LDLa 3499..3533 CDD:238060
LDLa 3582..3616 CDD:238060
LDLa 3621..3652 CDD:197566
LDLa 3663..3697 CDD:238060
LDLa 3702..3736 CDD:238060
LDLa 3776..3808 CDD:197566
LDLa 3818..3849 CDD:197566
LDLa 3860..3894 CDD:238060
NHL 4029..>4158 CDD:302697
NHL repeat 4034..4074 CDD:271320
NHL repeat 4076..4115 CDD:271320
LY 4108..4150 CDD:214531
NHL repeat 4121..4158 CDD:271320
EGF_CA <4386..4414 CDD:238011
EGF_CA 4415..4450 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126933
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.