DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and CG6739

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_609130.1 Gene:CG6739 FlyBaseID:FBgn0031926 Length:787 Species:Drosophila melanogaster

Alignment Length:866 Identity:172/867 (20%)
Similarity:274/867 (32%) Gaps:271/867 (31%)


Human   816 ESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDIL 880
            |:|::.||.|:  ....||...:|.            ::|:..|:.|.::      |.||.    
  Fly    13 ETSSVTGLRRQ--PTKYPHGLNITV------------QTIDDDNEGSPKD------HSDYT---- 53

Human   881 VFHSSRQSGWNECASSNGHCSHL----CLA-VPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQ 940
              .:|..|.|::  :...|...|    .|| :.|..:.....|:|.||:.......||.::|...
  Fly    54 --RASGDSCWSK--TQKYHIGMLGSPETLAELQVRRYKYPLTANYYLNSKLERPEKPTPWMLLGY 114

Human   941 KSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWID----SRQNMIRKAQEDGSQGFT 1001
            ..::.|...       :..||..:.:|  :.:..|.....|:.    :|...:::..|       
  Fly   115 ARSVCRWKY-------LRWPIIFVASV--LLFFGLITYCLWLHDVSVARAKFLQRRYE------- 163

Human  1002 VVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVI-----NVTRL-------DGRSVGVVLKG 1054
            ..::|..|.:.|:               |..|.|:..     ..|||       :...:..:..|
  Fly   164 ATLTSTSSSSNEV---------------WDEETTSSTERSPQETTRLEDMDDSDESTELPEIAFG 213

Human  1055 EQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVL-------FFSGLSKPIALAL--D 1110
            :...|.|   ..|.|                   ||...:.|       |.||......:.:  |
  Fly   214 DDGDPEA---GGEDG-------------------DGDYDDTLLPADSIRFTSGHQNSFGVPIEQD 256

Human  1111 SRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGR 1175
            .|:.:|.   .:|.....:..:|....:...|..|.|.           :....:..|.:.:| .
  Fly   257 KRMLQLL---KELLHKPQATPAGNEPTLTRVSPTLPPP-----------LSASGRPTEAMALT-T 306

Human  1176 EGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDE 1240
            ...|....:...|.....|.:.:|...|:....:|     .:.:...|...|.:|.:...    |
  Fly   307 PSTTNSGCQSTMLPMCQGVLDYDLTFNREGAAPRD-----AVSMAAYDSLIRANCSVRAA----E 362

Human  1241 LSCGE-PPTCSPQQF---------------TC--------FTGEI-DC--IPVA---WRCDGFTE 1275
            ..||. .|.|.|...               .|        ..||: ||  .|.|   .:|:..|.
  Fly   363 FICGALEPECRPLHIGQLPPCRRICKAILEACSIPIYNSDVLGELFDCNLYPDAHESHKCEDPTR 427

Human  1276 CEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRC-ANGQCI 1339
            ..|:        |..::|||..|.||....:|:...:||...||....::|..|:||| :|.:|:
  Fly   428 RRDY--------CYGNEFQCHDGSCIPQNWQCDKIKDCQGGEDEDEQCLVCEPDEFRCRSNEKCL 484

Human  1340 GKHKKCDHNVDCSDKSDELDC--YPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRM 1402
            .:..:||.|:||.|.|||.||  |.:.:.||...:.:.:...|           |.....|.|..
  Fly   485 VEKYRCDQNIDCMDGSDEQDCDEYGSGDLAPFDESELNAFPRV-----------FTYASFLSPNE 538

Human  1403 KGDGE----TMTND--------YVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMIS---SLSIM 1452
            ..|..    |.|.|        :.:|..|:      |.|...|.:..|....|..::   |..||
  Fly   539 TNDKVYTYITATTDEDAGTETKFQIHQVAA------PAPPVNSSAEEGAGGPKGFVNFRDSKEIM 597

Human  1453 GGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSY 1517
                             .:|.|.||                        |.||..:..|...:| 
  Fly   598 -----------------MTSDSETK------------------------FKYSQRANRTSVKFS- 620

Human  1518 RPYSYRHFAPPTTPC---STDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPT-----PR 1574
                   .:.||||.   |:.:..|.....|..|:..|....|:.....|....|..|     |.
  Fly   621 -------VSAPTTPAARTSSAIPSSALVQQRERTTSTTTTSTTTSTTTSSITSTPSITSTTLIPI 678

Human  1575 SQYLSAEENYE------SCPP 1589
            :...|....||      .|||
  Fly   679 NAATSEPNPYEVVTSLGGCPP 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275
NHL 55..272 CDD:302697
NHL repeat 55..93 CDD:271320
LY 89..127 CDD:214531
NHL repeat 97..132 CDD:271320
NHL repeat 140..176 CDD:271320
Ldl_recept_b 150..190 CDD:278487
LY 175..216 CDD:214531
NHL repeat 181..217 CDD:271320
NHL repeat 226..253 CDD:271320
LDL-receptor class B 5 237..276
FXa_inhibition 286..323 CDD:291342
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342
Beta-propeller 3 631..890 16/74 (22%)
LY 656..694 CDD:214531
LY 697..739 CDD:214531
LY 740..783 CDD:214531
LY 783..825 CDD:214531 4/9 (44%)
LY 827..866 CDD:214531 6/39 (15%)
FXa_inhibition 893..929 CDD:291342 9/41 (22%)
Beta-propeller 4 933..1202 44/294 (15%)
LY 958..998 CDD:214531 7/44 (16%)
Ldl_recept_b 1069..1110 CDD:278487 7/50 (14%)
LY 1094..1136 CDD:214531 9/51 (18%)
FXa_inhibition 1207..1243 CDD:291342 5/36 (14%)
LDLa 1249..1285 CDD:238060 12/65 (18%)
LDLa 1288..1322 CDD:238060 12/34 (35%)
LDLa 1326..1360 CDD:238060 17/35 (49%)
PPPSP motif A 1487..1493 0/6 (0%)
PPPSP motif B 1527..1534 5/10 (50%)
PPPSP motif C 1568..1575 3/12 (25%)
PPPSP motif D 1588..1593 2/3 (67%)
PPPSP motif E 1603..1610
CG6739NP_609130.1 CRD_FZ 314..427 CDD:143549 23/122 (19%)
LDLa 432..464 CDD:238060 12/32 (38%)
LDLa 470..505 CDD:238060 17/35 (49%)
LDLa 697..731 CDD:238060 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.