DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and Lrp4

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_727914.1 Gene:Lrp4 FlyBaseID:FBgn0030706 Length:2009 Species:Drosophila melanogaster

Alignment Length:1274 Identity:505/1275 (40%)
Similarity:758/1275 (59%) Gaps:57/1275 (4%)


Human     2 GAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIY 66
            |.:||..|..  |..|..|..||.|||.|:|.|..:|.:.:|  :|.||.:|.|:||....||::
  Fly   594 GYILRPDLRS--CKALGGAMTLLVANRWDIRRVTLSNNRYSA--IVKGLHNAIALDFHHRKGLMF 654

Human    67 WSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKV 131
            |||||.:.||....|.|. |::|:..||.||.|:|.||:.:.|:||||.|.|:||||..|:||.|
  Fly   655 WSDVSTDVIKMVYMNGTR-VRDVIKWGLESPGGIAVDWIHDLLFWTDSGTRRVEVSNFQGNLRTV 718

Human   132 LFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKL 196
            :...:||:||||.:.|.....:|:|||..||||||.|||:.|.:||:..:.|||||.:|:...|:
  Fly   719 IASYDLDKPRAIVVHPGEALAFWSDWGPNPKIERAYMDGTQRKVIISKGVTWPNGLAIDFPNSKI 783

Human   197 YWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREI 261
            ||||||.:.|..|||||::|..::...||||||||||||.:|||||:|.::.|.:|.||:..|.:
  Fly   784 YWADAKQHAIECSNLDGSDRNKILSTHLPHPFALTLFEDTMYWTDWNTKTVSAADKITGKEFRAV 848

Human   262 HSDIFSPMDIHAFSQQRQPNATNPCGID----NGGCSHLCLMSPVKPFYQCACPTGVKLLENGKT 322
            |.:...||||||:...|||...:.|..|    .||||||||  |.|...:|.||.|:.|.|:|||
  Fly   849 HENFHFPMDIHAYHPARQPEYADRCQKDRRGLRGGCSHLCL--PNKTSRRCGCPIGLSLKEDGKT 911

Human   323 CKDGATELLLLARRTDLR----RISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRA 383
            ||..|.:|:|:|||.|:|    |.:...|:..|:::.|::::||:|:|:.....:|||||.|...
  Fly   912 CKSTADKLVLVARRKDIRLRHLRDNQADPNDVDMIVPLDNLKHAVALDWCSDTDFIYWTDVERST 976

Human   384 IRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEP 448
            |.::.::||..|.||.:.:..|.|:|:||:...|||||..|:||||...||.||.:||.|.|.:|
  Fly   977 INKAHLNGSYQQRVVHSNLVSPVGLALDWITDKLYWTDPSTNRIEVATTNGKMRTLLIWEKLYKP 1041

Human   449 RAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDK 513
            |.||::|:.|:|:|:|||:.|.||||.:||.:||.:.:..|.:|||||:||::.|||:.|..|..
  Fly  1042 RDIVVNPIEGFMFWSDWGDDPMIERANMDGHERVTITSKKLIYPNGLAIDYEKSKIYFVDGGTKT 1106

Human   514 IEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSA-EREVIIDQLPDLMG 577
            :|.||.||:||:|:: :.:.|.||..:....|:||||..:|:...:|.:. :..|||....|||.
  Fly  1107 LENMNFDGSGRQVIL-NGLGHPFGLDVNEGRVFWTDWDTKSVMSANKLTGKDTNVIIANSTDLMD 1170

Human   578 LKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIV-PEAFLLFSRRAD 641
            ::..:..|....|.|.:.|||||||||..|....|||.:|.:|..|..||.. |..::||:.|.|
  Fly  1171 IRVFHRTRRRIFNACDKLNGGCSHLCLLNPTSYTCACTVGVQLKEDRHTCSEGPTQYILFAHRID 1235

Human   642 IRRISLETNN-NNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLD 705
            ||:|||:.:: .:|.:||..:..|.|||.|.....|||:|.....|..:..:|..::.:|...|:
  Fly  1236 IRQISLDFDHLIDVVLPLPPISNAVALDVDRKTGYIYWSDTIENVIMSSSPDGLHVQKIVGDSLE 1300

Human   706 YPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGK 770
            .|:|:.||.:|:.:||||.|.:.|||:.|||.:|.|:.:|||:|||.||||...|.::||:||..
  Fly  1301 NPDGLVVDSIGRTIYWADAGRHTIEVASLDGSNRHVIAYKDLESPRGLALDYEAGLLFWTDWGHY 1365

Human   771 PKIDRAAMDGSERTTLV-PNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPH 834
            .||:|:.:||:||:.:| .|:|..|||::|...:|:||.|.....|:|.:..|..|::|...|.|
  Fly  1366 RKIERSHLDGNERSRIVTANLGWPNGLSLDLKSKRIYWVDARLKTIDSCDYTGNQRKLIMSSLHH 1430

Human   835 PFGLTQYQDYIYWTDWSRRSI---ERANKTSGQNRTIIQGHLDYVMDI-LVFHSSRQSGW-NECA 894
            |:.|....|.||||||..:::   ||.|.::  .|.||. ::|.:||| :::.:..||.. |.|.
  Fly  1431 PYALALSDDNIYWTDWKSKALHMTERRNISA--KRDIIT-NIDGLMDIKIIYQNQNQSTMKNACG 1492

Human   895 SSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRT-C-SAPTTFLLFSQKSAINRMVIDEQQSPDI 957
            ::||:||||||..| .|:.|.||....|..::.| | :.|..:||.:.:|.|..:.::.....|:
  Fly  1493 NNNGNCSHLCLRNP-SGYSCQCPIGLRLRQNSTTQCQNLPEDYLLIALRSGIGMISLNSGDFMDV 1556

Human   958 ILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQ-EDGSQGFTVVVSSVPSQNLEIQPYDLSI 1021
            :|||:.:.....:||......|::.|...::||:.. .:.::...:|.:.|      :.|..:::
  Fly  1557 VLPINGVHGAVVLDYHYRKNLLFFADVNLDVIRRVNLLNLTESKVIVGTDV------LTPNGIAV 1615

Human  1022 DIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSP-KIER 1085
            |..:..:||:.....:|.|:||||.....:::.....||:::|:|:|.|:::::..  || ||||
  Fly  1616 DWIADNLYWSDTDRKLIEVSRLDGSCRKRIVEDNLGDPRSLIVHPKKAYLFWSDWS--SPAKIER 1678

Human  1086 AALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNIL----Q 1146
            :.|||:.|.|:..||:..|..|.:|....:|.|||:....|...|.:|..|     ..|:    .
  Fly  1679 SYLDGSNRTVIITSGIGFPTGLTIDFTNRRLLWADALEDNIGQVDFNGKRR-----QTIVPYAPH 1738

Human  1147 PVGLTVFEN---WLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCA 1208
            |.|||:|||   |..|.:|.....:|:..:|.....:|:..::...||.|| .|:.|....:.||
  Fly  1739 PFGLTLFENSIFWTDWYNKSVYRSQKLARSGYGNPFEVRDALSGALDIRAV-SLSRQPKSVNHCA 1802

Human  1209 QDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPP 1247
            ||||||:|:||.:..... |:||.  |:...:::|...|
  Fly  1803 QDNGGCTHLCLNRNVDYV-CACPD--VMDPKDVACSIKP 1838

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275 127/255 (50%)
NHL 55..272 CDD:302697 110/217 (51%)
NHL repeat 55..93 CDD:271320 16/38 (42%)
LY 89..127 CDD:214531 21/38 (55%)
NHL repeat 97..132 CDD:271320 20/35 (57%)
NHL repeat 140..176 CDD:271320 19/36 (53%)
Ldl_recept_b 150..190 CDD:278487 21/40 (53%)
LY 175..216 CDD:214531 21/41 (51%)
NHL repeat 181..217 CDD:271320 20/36 (56%)
NHL repeat 226..253 CDD:271320 18/27 (67%)
LDL-receptor class B 5 237..276 18/39 (46%)
FXa_inhibition 286..323 CDD:291342 21/41 (51%)
Beta-propeller 2 328..589 108/266 (41%)
LY 353..393 CDD:214531 14/40 (35%)
LY 397..437 CDD:214531 20/40 (50%)
LY 438..481 CDD:214531 22/43 (51%)
LY 483..524 CDD:214531 19/41 (46%)
LY 525..558 CDD:214531 10/33 (30%)
FXa_inhibition 592..627 CDD:291342 18/35 (51%)
Beta-propeller 3 631..890 104/265 (39%)
LY 656..694 CDD:214531 13/38 (34%)
LY 697..739 CDD:214531 18/42 (43%)
LY 740..783 CDD:214531 22/43 (51%)
LY 783..825 CDD:214531 15/43 (35%)
LY 827..866 CDD:214531 15/42 (36%)
FXa_inhibition 893..929 CDD:291342 16/37 (43%)
Beta-propeller 4 933..1202 76/278 (27%)
LY 958..998 CDD:214531 9/41 (22%)
Ldl_recept_b 1069..1110 CDD:278487 16/42 (38%)
LY 1094..1136 CDD:214531 13/42 (31%)
FXa_inhibition 1207..1243 CDD:291342 15/36 (42%)
LDLa 1249..1285 CDD:238060
LDLa 1288..1322 CDD:238060
LDLa 1326..1360 CDD:238060
PPPSP motif A 1487..1493
PPPSP motif B 1527..1534
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
Lrp4NP_727914.1 LDLa 267..301 CDD:238060
LDLa 306..340 CDD:238060
LDLa 347..390 CDD:238060
LDLa 397..431 CDD:238060
LDLa 442..476 CDD:238060
LDLa 480..521 CDD:238060
FXa_inhibition 576..604 CDD:291342 4/12 (33%)
LY 634..671 CDD:214531 17/37 (46%)
NHL <656..793 CDD:302697 69/138 (50%)
LY 680..714 CDD:214531 20/34 (59%)
NHL repeat 681..722 CDD:271320 22/41 (54%)
NHL repeat 726..760 CDD:271320 18/34 (53%)
LY 761..803 CDD:214531 21/42 (50%)
NHL repeat 769..793 CDD:271320 13/24 (54%)
FXa_inhibition 882..912 CDD:291342 19/32 (59%)
LY 946..985 CDD:214531 13/39 (33%)
NHL <967..1142 CDD:302697 83/176 (47%)
LY 988..1030 CDD:214531 21/42 (50%)
NHL repeat 998..1037 CDD:271320 22/39 (56%)
NHL repeat 1038..1080 CDD:271320 21/42 (50%)
NHL repeat 1084..1119 CDD:271320 19/35 (54%)
FXa_inhibition 1185..1220 CDD:291342 18/35 (51%)
NHL 1260..>1445 CDD:302697 77/185 (42%)
NHL repeat 1260..1296 CDD:271320 11/36 (31%)
NHL repeat 1302..1337 CDD:271320 18/35 (51%)
NHL repeat 1345..1383 CDD:271320 19/38 (50%)
FXa_inhibition <1499..1525 CDD:291342 11/27 (41%)
LY 1600..1640 CDD:214531 12/46 (26%)
LY 1643..1686 CDD:214531 15/45 (33%)
LY 1688..1729 CDD:214531 13/41 (32%)
FXa_inhibition 1801..>1825 CDD:291342 14/25 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D121310at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126933
Panther 1 1.100 O PTHR24270
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.