DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and yl

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_996433.1 Gene:yl FlyBaseID:FBgn0004649 Length:1984 Species:Drosophila melanogaster

Alignment Length:1111 Identity:313/1112 (28%)
Similarity:465/1112 (42%) Gaps:195/1112 (18%)


Human   592 CAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTC--IV-----PEAFLLFSRRADIRRISLET 649
            |.|::..||..|.....|.||.|..|:.|..|.:||  :|     .:..||::.:..|..:.|..
  Fly   352 CKEQDDLCSQGCENTSGGYRCVCDAGYLLDKDNRTCRAVVYGSKEQQPLLLYTTQMTIMGMHLRE 416

Human   650 NN--NNVAIPLTGVKEASALDFDVTDNRIYWTDI--SLKTISRAFMNGSALEHVVEFGLDYPEGM 710
            :|  |:|......:.:...:.:|  .:.||||:|  ..::|.:|..:||..|.::..|||.||.:
  Fly   417 DNVRNHVYQVAGNLSKVIGVAYD--GSHIYWTNIQNEAESIVKANGDGSNAEILLTSGLDAPEDL 479

Human   711 AVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDR 775
            |||||.:|:|::|.....|.|...||.:..|||.:|:..||:||:.|.:|.|:||:||.||.|.|
  Fly   480 AVDWLTQNIYFSDNIMRHIAVCSNDGLNCAVLVTQDVHQPRSLAVWPQKGLMFWTDWGEKPMIGR 544

Human   776 AAMDGSERTTLV-PNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADD-LPHPFGL 838
            |:||||....:| .|:...||:.:|..::|:||.|.....:::....|..|..:.|. |.||:||
  Fly   545 ASMDGSRSRPIVSDNIEWPNGIALDMHQQRIYWVDAKLGSVQTVRPDGTGRRTVLDGMLKHPYGL 609

Human   839 TQYQDYIYWTDWSRRSIERANKTSG-------QNRTIIQGHLDYVMDILVFHSSRQSGWNECASS 896
            ..::|.:||:||:.:|:...:|.||       ::|||...|        ::|.::|.. :.....
  Fly   610 AIFEDQLYWSDWATKSVHACHKFSGKDHRILAKDRTIYAVH--------IYHPAKQPN-SPHGCE 665

Human   897 NGHCSHLC-LAVP-VGGFVCGCPAHYSLNADNRTCSAPT----------TFLLFSQKSAINRMVI 949
            |..||||| ||.| :||..|.||....|..|:|.|....          ..||..:.:|..|   
  Fly   666 NATCSHLCLLAEPEIGGHSCACPDGMRLAPDHRRCMLMEKRQRLFIGLGQVLLEIEHTAFGR--- 727

Human   950 DEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEI 1014
             .|.|....||.    .:..:.|:.::..|...|:.|.:|.:.|.:..:...:|.|::.:.:.  
  Fly   728 -HQVSKSYTLPC----LINEMVYNRINGSLIIADNDQRLILEFQPESHESNVLVRSNLGNVSA-- 785

Human  1015 QPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVV--LKGEQDRPRAVVVNPEKGYMYFTNLQ 1077
                |:.|..||.:||......||.|..|..|...::  ..| |:.|..:.|.|.:||:|.....
  Fly   786 ----LAFDHLSRNLYWADTERAVIEVLSLQTRHRALIRFFPG-QEVPIGLTVMPAEGYLYVVLKA 845

Human  1078 ERSPKIERAALDGTEREVLFFS---GLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVL 1139
            :|...|::..|.|...:|..|.   | ...|.|..|.....:||:||||.||..|:....:..:.
  Fly   846 KRHSHIDKIPLSGKGEQVHVFEDDLG-DDDIKLVTDYETQTIFWSDSDLGRISYSNYRVPHSQIF 909

Human  1140 EDSNILQPVGLTVFEN---W-------LYWIDKQQQMIEK-IDMTGREGRTKVQ--ARIAQLSDI 1191
            . ..:.:|..|.:..:   |       :||..|......| ||:..::....:.  ..:|..:.|
  Fly   910 R-GKLRRPYSLAMVHHDLFWNELGTPRIYWTHKSNMGPRKVIDIMEKDDPAAIMPYVPVATPNGI 973

Human  1192 HAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQ-DELSCGEPPTCSPQQFT 1255
            .......:.: ..|||.|.||||||||:.:|...:.|.||...|... ...:|.|...|   :|.
  Fly   974 PLAASSPVGQ-ESHPCQQQNGGCSHICVGEGPYHSICLCPAGFVYRDAGNRTCVEALDC---EFR 1034

Human  1256 CFTGEIDCIPVAWRCDGFTECEDHSDELNCP---------VCSESQFQCASG-QCIDGALRCNGD 1310
            |.:||  |:.:..||:|..:|.|:|||:||.         :||.:||.|.|| ||:|...||:..
  Fly  1035 CHSGE--CLTMNHRCNGRRDCVDNSDEMNCDEEHRRKPKVLCSPNQFACHSGEQCVDKERRCDNR 1097

Human  1311 ANCQDKSDEKNCEVL-----CLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQA 1370
            .:|.|.|||::||..     |.:.|..|.||:|:.....||...||.|.||||.|..|....|  
  Fly  1098 KDCHDHSDEQHCEKFDKSKKCHVHQHGCDNGKCVDSSLVCDGTNDCGDNSDELLCEATSRCEP-- 1160

Human  1371 TNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGS 1435
                    |:           |.|         |.|..:...:...|......|...|...:..|
  Fly  1161 --------GM-----------FQC---------GSGSCIAGSWECDGRIDCSDGSDEHDKCVHRS 1197

Human  1436 L-PGMSR---GKSMISSLSIMG-GSSGPPYDRAHV-TGASSSSSSSTKGTYFPAILNPPPSPATE 1494
            . |.|.|   |:.:..||...| ...|...|..:. |.:|:.:.|..:..|              
  Fly  1198 CPPDMQRCLLGQCLDRSLVCDGHNDCGDKSDELNCGTDSSTMNISCAEDQY-------------- 1248

Human  1495 RSHYTMEFGYSSN----SPSTHRSYSYRPYSYRHFAPPTTPCST--------DVCDSDYAPSRRM 1547
                    ..:||    .|||.|...            ||.|..        ||| |.|....|.
  Fly  1249 --------QCTSNLKICLPSTVRCNG------------TTECPRGEDEADCGDVC-SIYEFKCRS 1292

Human  1548 TSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAE-----ENYESCPPSPYTERSYSHHLYPPPPS 1607
            ......:.:..|...|.       ...|..||.|     .|.....|...:.||...||:.....
  Fly  1293 GRECIRREFRCDGQKDC-------GDGSDELSCELEKGHHNQSQIQPWSTSSRSCRPHLFDCQDG 1350

Human  1608 PCTDSS 1613
            .|.|.|
  Fly  1351 ECVDLS 1356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275
NHL 55..272 CDD:302697
NHL repeat 55..93 CDD:271320
LY 89..127 CDD:214531
NHL repeat 97..132 CDD:271320
NHL repeat 140..176 CDD:271320
Ldl_recept_b 150..190 CDD:278487
LY 175..216 CDD:214531
NHL repeat 181..217 CDD:271320
NHL repeat 226..253 CDD:271320
LDL-receptor class B 5 237..276
FXa_inhibition 286..323 CDD:291342
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342 13/35 (37%)
Beta-propeller 3 631..890 91/272 (33%)
LY 656..694 CDD:214531 9/40 (23%)
LY 697..739 CDD:214531 18/42 (43%)
LY 740..783 CDD:214531 24/43 (56%)
LY 783..825 CDD:214531 10/43 (23%)
LY 827..866 CDD:214531 15/47 (32%)
FXa_inhibition 893..929 CDD:291342 17/38 (45%)
Beta-propeller 4 933..1202 65/297 (22%)
LY 958..998 CDD:214531 8/40 (20%)
Ldl_recept_b 1069..1110 CDD:278487 12/44 (27%)
LY 1094..1136 CDD:214531 15/45 (33%)
FXa_inhibition 1207..1243 CDD:291342 15/37 (41%)
LDLa 1249..1285 CDD:238060 15/36 (42%)
LDLa 1288..1322 CDD:238060 17/35 (49%)
LDLa 1326..1360 CDD:238060 15/34 (44%)
PPPSP motif A 1487..1493 0/6 (0%)
PPPSP motif B 1527..1534 3/7 (43%)
PPPSP motif C 1568..1575 0/7 (0%)
PPPSP motif D 1588..1593 1/5 (20%)
PPPSP motif E 1603..1610 1/7 (14%)
ylNP_996433.1 LDLa 90..124 CDD:238060
LDLa 131..166 CDD:238060
LDLa 184..216 CDD:238060
LDLa 227..262 CDD:238060
LDLa 271..302 CDD:238060
FXa_inhibition 352..387 CDD:291342 13/35 (37%)
Ldl_recept_b 442..482 CDD:278487 17/40 (43%)
LY 466..508 CDD:214531 18/42 (43%)
Ldl_recept_b 529..569 CDD:278487 19/40 (48%)
LY 553..595 CDD:214531 10/42 (24%)
LY 596..637 CDD:214531 15/41 (37%)
FXa_inhibition 669..700 CDD:291342 16/31 (52%)
LY 774..815 CDD:214531 13/47 (28%)
LDLa 1032..1062 CDD:238060 14/32 (44%)
LDLa 1074..1109 CDD:238060 17/35 (49%)
LDLa 1118..1152 CDD:238060 15/34 (44%)
LDLa 1157..1189 CDD:197566 8/62 (13%)
LDLa 1198..1232 CDD:238060 9/34 (26%)
LDLa 1243..1279 CDD:238060 10/70 (14%)
LDLa 1283..1318 CDD:238060 9/43 (21%)
LDLa 1340..1371 CDD:197566 5/18 (28%)
FXa_inhibition 1388..1416 CDD:291342
EGF_CA 1418..1452 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126933
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.