DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LRP6 and LpR1

Sequence 1:NP_002327.2 Gene:LRP6 HGNCID:6698 Length:1613 Species:Homo sapiens
Sequence 2:NP_001097934.2 Gene:LpR1 FlyBaseID:FBgn0066101 Length:1076 Species:Drosophila melanogaster

Alignment Length:419 Identity:160/420 (38%)
Similarity:226/420 (54%) Gaps:40/420 (10%)


Human    23 LLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQ 87
            ||.|.|.|:|.: |.:..| .|.:|...:.|.|:||||..|:|:||||:.::|.:...::.....
  Fly   599 LLLARRHDIRKI-ALDHME-MTSIVNSTKAATALDFVFRTGMIFWSDVTTQSIYKAPIDEGNEKT 661

Human    88 NVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFM 152
            .|:....::.||||.||:...:|:||:....||::|.:||:.|||....||.||:|||||..|:|
  Fly   662 VVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWM 726

Human   153 YWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQ 217
            ||:|||..|:|||||||||.|..||:.::.||||:|||..::::||.|.|||.|..:|.||:.|.
  Fly   727 YWSDWGASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRS 791

Human   218 AVVKGS--LPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREI---HSDIFSPMDIHAFSQQ 277
            .|:...  |.|||::|.|||.:|||||...::...||:|||.:..:   |. :..||.:|.:...
  Fly   792 QVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHM-LQHPMVVHVYHPY 855

Human   278 RQPNATNPCGIDNGGCSHLCLMSP----VKPFYQCACPTGVKLLENGKTCKDGATELLLL----- 333
            |||:..|.|...||.||||||.:|    ..|...||||||:||:.:|..|.:....|..:     
  Fly   856 RQPDGVNHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMVDGLMCVEDPLYLPPVTRPPR 920

Human   334 ARRTDLR----RISLDT---PDFTDIVLQLED----------IRHAIAIDYDPVEGYIYWTDDEV 381
            ||:|..|    |..|.|   ....||.:::.|          :......|..||:.:   |..|.
  Fly   921 ARKTKPRPKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTFVADQRPVKNH---TQIEK 982

Human   382 RAIRRSFIDGSGSQFVVTAQIAHPDGIAV 410
            ........|   |.|:....||...|.||
  Fly   983 TTTPSEQPD---SGFIALVVIASLSGFAV 1008

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LRP6NP_002327.2 Beta-propeller 1 20..275 111/257 (43%)
NHL 55..272 CDD:302697 99/222 (45%)
NHL repeat 55..93 CDD:271320 13/38 (34%)
LY 89..127 CDD:214531 14/38 (37%)
NHL repeat 97..132 CDD:271320 16/35 (46%)
NHL repeat 140..176 CDD:271320 25/36 (69%)
Ldl_recept_b 150..190 CDD:278487 26/40 (65%)
LY 175..216 CDD:214531 19/41 (46%)
NHL repeat 181..217 CDD:271320 18/36 (50%)
NHL repeat 226..253 CDD:271320 14/27 (52%)
LDL-receptor class B 5 237..276 14/42 (33%)
FXa_inhibition 286..323 CDD:291342 20/41 (49%)
Beta-propeller 2 328..589 24/106 (23%)
LY 353..393 CDD:214531 7/50 (14%)
LY 397..437 CDD:214531 5/15 (33%)
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342
Beta-propeller 3 631..890
LY 656..694 CDD:214531
LY 697..739 CDD:214531
LY 740..783 CDD:214531
LY 783..825 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:291342
Beta-propeller 4 933..1202
LY 958..998 CDD:214531
Ldl_recept_b 1069..1110 CDD:278487
LY 1094..1136 CDD:214531
FXa_inhibition 1207..1243 CDD:291342
LDLa 1249..1285 CDD:238060
LDLa 1288..1322 CDD:238060
LDLa 1326..1360 CDD:238060
PPPSP motif A 1487..1493
PPPSP motif B 1527..1534
PPPSP motif C 1568..1575
PPPSP motif D 1588..1593
PPPSP motif E 1603..1610
LpR1NP_001097934.2 LDLa 135..167 CDD:197566
LDLa 178..210 CDD:197566
LDLa 219..254 CDD:238060
LDLa 259..295 CDD:238060
LDLa 343..373 CDD:238060
LDLa 383..415 CDD:197566
Ldl_recept_a 423..459 CDD:278486
LDLa 476..504 CDD:197566
FXa_inhibition 514..549 CDD:291342
EGF_CA 551..581 CDD:214542
LY 662..702 CDD:214531 15/40 (38%)
LY 704..747 CDD:214531 29/43 (67%)
LY 749..790 CDD:214531 19/41 (46%)
FXa_inhibition 864..905 CDD:291342 20/41 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24270
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.