DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfAP-2 and TFAP2D

Sequence 1:NP_001262178.1 Gene:TfAP-2 FlyBaseID:FBgn0261953 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_758438.2 Gene:TFAP2D HGNCID:15581 Length:452 Species:Homo sapiens

Alignment Length:474 Identity:202/475 (43%)
Similarity:264/475 (56%) Gaps:88/475 (19%)


  Fly    21 RLSGHGSL-GLSSGSAAYT-----THSGGHTGRSGPATGHSGHSSTHGSAATMHHQSLQSDFQ-- 77
            ||...|.| .:::.:.||:     |:|...|..:.|      :.||:.....:||||...:||  
Human    23 RLMQLGCLESVANSTVAYSSSSPLTYSTTGTEFASP------YFSTNHQYTPLHHQSFHYEFQHS 81

  Fly    78 -PPYFPPPF-----HHSTQSPPQQQISGYLQNHGALEYLGTDPYGQPLSSLHHAPLHHYNQLAG- 135
             |...|..:     |||.|.        |.|.|          :|:|...::   ||:...|.. 
Human    82 HPAVTPDAYSLNSLHHSQQY--------YQQIH----------HGEPTDFIN---LHNARALKSS 125

  Fly   136 -LRSTQDQLGIHRTHREAELQGHVTQLSHGFPY---TDRRSDYGSAISAGAAHGTRLGHEHESLA 196
             |...:.:||....:|..:|    :.:|||..|   .|:|...|.::...||             
Human   126 CLDEQRRELGCLDAYRRHDL----SLMSHGSQYGMHPDQRLLPGPSLGLAAA------------- 173

  Fly   197 LHQALQNAVDDVQAPALDDNVAFMSDLPLIKSMKSGKEAGNIGSG-----SPSEVFCAVPGRLSL 256
                   ..||:|.     :|.....|.|      ..:.|.|..|     :|:::||:|||||||
Human   174 -------GADDLQG-----SVEAQCGLVL------NGQGGVIRRGGTCVVNPTDLFCSVPGRLSL 220

  Fly   257 LSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIGLNLPAGRRKAAN 321
            ||||||||||||||:||||||||||||||||:|||||||||||.|||||:::|||||||||||||
Human   221 LSSTSKYKVTIAEVKRRLSPPECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAAN 285

  Fly   322 VTLLTSLVEGEATHLAKDFHFVCETEFPARQLAEYIVRHQTEPQDSYRRKELILHSQQITKELMQ 386
            ||||||||||||.|||:||.:.|||||||:.:.|::.|...|.::...||::||.::||.||...
Human   286 VTLLTSLVEGEALHLARDFGYTCETEFPAKAVGEHLARQHMEQKEQTARKKMILATKQICKEFQD 350

  Fly   387 ILSQDRTTHFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVLHAFQTFLNESLNYLEKLYPS 451
            :|||||:....:|...:|:..:|||||||||||||||:|||.|.|..|||.|:|.||||||....
Human   351 LLSQDRSPLGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTH 415

  Fly   452 NGGGMVSSSLDKSKIDNEK 470
            ..||...|.  :...::||
Human   416 KNGGAADSG--QGHANSEK 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfAP-2NP_001262178.1 TF_AP-2 245..445 CDD:281315 138/200 (69%)
TFAP2DNP_758438.2 TF_AP-2 211..405 CDD:308749 135/194 (70%)
H-S-H (helix-span-helix), dimerization. {ECO:0000255} 280..410 77/130 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52400553
eggNOG 1 0.900 E1_KOG3811
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 324 1.000 Inparanoid score I2461
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D287275at33208
OrthoFinder 1 1.000 FOG0000377
OrthoInspector 1 1.000 T608656
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10812
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.