DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SAK and Plk2

Sequence 1:NP_649324.1 Gene:SAK FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_114009.1 Gene:Plk2 RGDID:620760 Length:682 Species:Rattus norvegicus

Alignment Length:582 Identity:148/583 (25%)
Similarity:245/583 (42%) Gaps:163/583 (28%)


  Fly    19 LLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQD 83
            :|||||||..|:...|..::..|.|:|....:.......::.:|:|:|..|.|..|:|.|.:|:|
  Rat    84 VLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHKHVVQFYHYFED 148

  Fly    84 ANYVYLVLELAHNGELHRYMNHIARP---FTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLL 145
            ...:|::||...    .|.|.||.:.   .||.|....|:|:|:||.|||...|:|||:.|.|..
  Rat   149 KENIYILLEYCS----RRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFF 209

  Fly   146 LSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGR 210
            ::..|.:|:.|||||.:|:..:.|..|:||||||:||||:::..||..:|:|::||::||:|:||
  Rat   210 INEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGR 274

  Fly   211 PPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLK------ 269
            |||||..::.|...:..:.|.||:.|...|:.||..:|.|.|.:|.:|:.::.|.|.|:      
  Rat   275 PPFETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDR 339

  Fly   270 -CSNGGHSAPG------ALNVFSQSMESGDSGIITFASSDSRNSQQIRSVENSGPQQVLPQIREE 327
             .|:..|:.|.      |.|.|.::..:...|                           .:.:..
  Rat   340 LSSSCCHTVPDFHLSSPAKNFFKKAAAALFGG---------------------------KKDKAR 377

  Fly   328 FKQVHHKLPYEQTGLFGQASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTK 392
            :...|:|:..|...::                              ..:..||:..|:..     
  Rat   378 YNDTHNKVSKEDEDIY------------------------------KLRHDLKKTSITQQ----- 407

  Fly   393 RLLPTRYKTKNAIM----SILRNGEVVLEFLKFRPTYNEDRINDICR------------------ 435
               |::::|...:.    :..::|...:|        |:.:|.|..|                  
  Rat   408 ---PSKHRTDEELQPPPTTFAKSGTSAVE--------NKQQIGDAIRMIVRGTLGSCSSSSECLE 461

  Fly   436 ------ISDDGQRIIIYQPDPGRGLPVREQPPDLQ-IPSGDCVYNYDNLPSKHW--------KKY 485
                  ::|...|::       ||.        |: :|..||:.......|..|        .||
  Rat   462 DSTMGSVADTVARVL-------RGC--------LENMPEADCIPKEQLSTSFQWVTKWVDYSNKY 511

  Fly   486 IYGARF----VG-----------LVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLK 532
            .:|.:.    ||           |...||  |.|::.||:|.:... ||...:|.|...:||
  Rat   512 GFGYQLSDHTVGVLFNNGAHMSLLPDKKT--VHYYAELGQCSVFPA-TDAPEQFISQVTVLK 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 97/251 (39%)
S_TKc 14..267 CDD:214567 97/251 (39%)
POLO_box_Plk4_1 382..497 CDD:240557 25/167 (15%)
POLO_box_Plk4_2 498..596 CDD:240558 13/36 (36%)
POLO_box_Plk4_3 657..738 CDD:240559
Plk2NP_114009.1 STKc_PLK2 77..331 CDD:271090 97/251 (39%)
S_TKc 79..331 CDD:214567 97/251 (39%)
POLO_box_1 500..585 CDD:240561 20/75 (27%)
POLO_box_2 598..679 CDD:240560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.