DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp1 and Alpi

Sequence 1:NP_001262159.1 Gene:Alp1 FlyBaseID:FBgn0283479 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001074551.1 Gene:Alpi MGIID:1924018 Length:554 Species:Mus musculus

Alignment Length:506 Identity:223/507 (44%)
Similarity:290/507 (57%) Gaps:35/507 (7%)


  Fly    35 SELKSKEFWFHDAQRTLYNKLSTPPNQYRAKNVIFFLGDGMSVPTVTAGRIFDGQLRGVVGERNR 99
            :|.::..||...|...|.......|.|..|||:|.||||||.||||||.||..|||.|.:|....
Mouse    24 AEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETP 88

  Fly   100 LEFEKFNYVGLSKTYCVNKQVADSACTASAYLSGIKANYLTIGVTADVELNDCRGSRLPQNRLSS 164
            |..:.|.|:.|||||.|::||.|||.||:|||.|:||||.|||::|...|:.|..:.  .|.:.|
Mouse    89 LAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTF--GNEVFS 151

  Fly   165 IAAWALKGSKSAGLVTTTRVTHASPAGVYAHTSNRDFESDYDVTKLGQNPGNCPDIAQQLIDG-D 228
            :...|.|..||.|:||||||.||||||.||||.||::.||.::.......| |.|||.|||.. |
Mouse   152 VMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDG-CKDIATQLISNMD 215

  Fly   229 VGKRLRVVMGGGTIKFLPNTTNDV-----FGNKGQRLDNRNLIEEWQQTKPGNARVVFSRTDLL- 287
            :.    |::|||.....|..|.|.     ....|.|||::||::.|.....| ||.|::|::|: 
Mouse   216 ID----VILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQG-ARYVWNRSELIQ 275

  Fly   288 -NNDAQNTDFLLGLFNASHLAY--HMDDSIDTPTLPEMTAAAINVLSRDPNGYFLFVEGGRIDHA 349
             :.|...| .|:|||..:.:.|  :.:.|:| |:|.|||..|:.:|||:|.|::|||||||||..
Mouse   276 ASQDPAVT-HLMGLFEPTEMKYDANRNPSVD-PSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQG 338

  Fly   350 HHETKAKKALDETVQFSDAVRKARQLTNPWDTLIVVSADHGHTVTISGYPDVNNSIVGLNSELSN 414
            ||...|..||.|.|.|..|:.||.||||..||||:::|||.|.....||.....||.|| :.|..
Mouse   339 HHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGL-APLKA 402

  Fly   415 VDQLPYTSISYANGPAYERFYKSTDGVVERVDLRNLDFSKPDAIYPHGVPMTEETHGGGDVAVYA 479
            :|...||||.|.|||.||....:...|.|   .:::|   |:......||::.|||||.|||::|
Mouse   403 LDDKSYTSILYGNGPGYELKSGNRPNVTE---AQSVD---PNYKQQAAVPLSSETHGGEDVAIFA 461

  Fly   480 HVVEYLLQGPWSHLFTGVYEQSTLPHLMGFASCLGPGITYCDLQPKARYSP 530
                   :||.:||..||.||:.:.|:|.||.||.| .|.|.|.|.|..||
Mouse   462 -------RGPQAHLVHGVQEQNYIAHVMAFAGCLEP-YTDCGLAPPAGQSP 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp1NP_001262159.1 alkPPc 65..514 CDD:214515 207/459 (45%)
AlpiNP_001074551.1 Alk_phosphatase 53..488 CDD:278666 207/459 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21910685
eggNOG 1 0.900 E1_COG1785
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T130886
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.