DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp1 and Alp5

Sequence 1:NP_001262159.1 Gene:Alp1 FlyBaseID:FBgn0283479 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_650931.1 Gene:Alp5 FlyBaseID:FBgn0038845 Length:522 Species:Drosophila melanogaster

Alignment Length:482 Identity:225/483 (47%)
Similarity:299/483 (62%) Gaps:25/483 (5%)


  Fly    42 FWFHDAQRTLYNKLSTPPNQYRAKNVIFFLGDGMSVPTVTAGRIFDGQLRGVVGERNRLEFEKFN 106
            :|.....:.:..||::.||:.:|||||.||||||.|.|.:|.|...|      ||...|.||.|.
  Fly    62 YWRQQGVQFVQQKLASEPNKRQAKNVILFLGDGMGVTTTSAARNLLG------GEEKSLSFENFP 120

  Fly   107 YVGLSKTYCVNKQVADSACTASAYLSGIKANYLTIGVTADVELNDCRGSRLPQNRLSSIAAWALK 171
            :.||||||.|:|.|.||||||:|||.|:|....||||...|...||:........:.|||.||::
  Fly   121 FTGLSKTYSVDKIVPDSACTATAYLCGVKGQEGTIGVNGQVPRTDCKVMLDESTHVDSIAKWAME 185

  Fly   172 GSKSAGLVTTTRVTHASPAGVYAHTSNRDFESDYDV-TKLGQNPGNCPDIAQQLIDGDVGKRLRV 235
            ..|.||||||||||||||:|||||.:.||:|:|.:| |..|...| ..|||.||..|:||.:|:|
  Fly   186 AGKWAGLVTTTRVTHASPSGVYAHIAERDWENDAEVATDCGAGSG-INDIAYQLARGEVGSKLKV 249

  Fly   236 VMGGGTIKFLPNTTNDVFGNKGQRLDNRNLIEEWQQTKPGNARVVFSRTDLLNNDAQNTDFLLGL 300
            :||||...|:.::..    :.|:|.|..|||:|::.....|..|. :..:|...|...||.||||
  Fly   250 IMGGGRKHFVDSSLE----SWGKRTDGLNLIDEFKSASENNVYVT-TAAELAAVDVTKTDRLLGL 309

  Fly   301 FNASHLAYHMDDSIDT--PTLPEMTAAAINVLSRDPNGYFLFVEGGRIDHAHHETKAKKALDETV 363
            ||..||.|.|:.:.::  |||.:||..||..:|::..|||||:||||||.|||..:|:.||:||:
  Fly   310 FNDDHLQYLMETTTESSQPTLEQMTRKAIEYMSQNEQGYFLFIEGGRIDQAHHINQARMALNETI 374

  Fly   364 QFSDAVRKARQLTNPWDTLIVVSADHGHTVTISGYPDVNNSIVGLNSELSNVDQLPYTSISYANG 428
            :||.|:..|::||:..|||:||:|||.|..|.:||....:.:.| .:.::..|..||..:|||||
  Fly   375 EFSKAIAAAQELTSEDDTLLVVTADHSHVFTYAGYSYRGSDVFG-KTPVNGHDGKPYMVLSYANG 438

  Fly   429 PAYERFYKSTDGVVERVDLRNLDFSKPDAIYPHGVPMTEETHGGGDVAVYAHVVEYLLQGPWSHL 493
            |:||.||.:.  .:||.|...:.....|..:|.|||:..::|||.||.|||       .|||:||
  Fly   439 PSYENFYDAE--TMERKDPTTVVKGDHDDEFPSGVPIDMDSHGGDDVPVYA-------LGPWAHL 494

  Fly   494 FTGVYEQSTLPHLMGFASCLGPGITYC 520
            |||||||||:||:|.:|||||.|.|.|
  Fly   495 FTGVYEQSTIPHMMAYASCLGDGHTMC 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp1NP_001262159.1 alkPPc 65..514 CDD:214515 215/452 (48%)
Alp5NP_650931.1 Alk_phosphatase 84..514 CDD:278666 215/452 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455487
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 383 1.000 Inparanoid score I1952
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R959
87.920

Return to query results.
Submit another query.