DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and TAF8

DIOPT Version :8

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_567964.1 Gene:TAF8 / 829584 AraportID:AT4G34340 Length:353 Species:Arabidopsis thaliana

Alignment Length:298 Identity:61/299 (20%)
Similarity:106/299 (35%) Gaps:80/299 (27%)


  Fly    21 CEVVD-DVLRQSMLELLRG----KFREIARQTTNWSNHAGRCAPSYFDL---------------- 64
            ||.|. :..:...||.|.|    ...::.:..|:::|..||...:.||:                
plant    39 CESVGYENFKDPALESLSGFALQYILQLGKTATSFANLTGRSQCNVFDIILALDDLTDNNGEQGI 103

  Fly    65 --ERTFIRMNIKVGELKAMYEGQPDSLVLVECNAPETQDQDFHSVPQPVLSSTKA-----VELAS 122
              |...:..:||:.|:          :..|..:......|...|.|..:...::.     ||:..
plant   104 SSESCSLGRSIKLREI----------IDFVNSSEEVPFSQPLPSFPVAISDRSRKMIPSFVEIGE 158

  Fly   123 T---TYIPDHLPPFPGAHTYKSST--IEKVT----DRSYVAMRNRHAENELNTQNALNQYYLRC- 177
            |   .:||..||.||..||||.:.  ||:|:    |:...|.:.|.||..|.:.    |..|.| 
plant   159 TPPGKHIPLWLPAFPDPHTYKETPMWIERVSDPRGDKIEQARQRRKAERALLSL----QRKLVCK 219

  Fly   178 ----NP---NISLFEETQRDGSGHVLDLGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDC 235
                ||   ::...:|..||....:..:...:|:          :..:.|..:.||...      
plant   220 ISSRNPVWGDMDGVKEEMRDDESELRSVSSGEKV----------ESLNRDGLSVIEAFA------ 268

  Fly   236 RYLEKPKLHSSRPSSGNFEEEDVEMEEPCSPGGLGIEK 273
                 |.:.::|....:....:.:..:|.:...|..||
plant   269 -----PAMEAARDGFSSEAHTEWKKNKPVALSKLRTEK 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 16/79 (20%)
TAF8 125..177 CDD:176263 21/58 (36%)
TAF8NP_567964.1 Bromo_TP 24..100 CDD:284856 13/61 (21%)
TAF8 164..216 CDD:176263 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
10.910

Return to query results.
Submit another query.