DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and taf8

DIOPT Version :8

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_012818203.1 Gene:taf8 / 549471 XenbaseID:XB-GENE-491356 Length:293 Species:Xenopus tropicalis

Alignment Length:271 Identity:71/272 (26%)
Similarity:110/272 (40%) Gaps:36/272 (13%)


  Fly     8 LATVLDNLLASKNCEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLERTFIRMN 72
            |..|:.:||.....|..:....:|:.|:|:....||.|...::..|..|..|:..|:..|.|.|.
 Frog    27 LQVVVSSLLTEAGFESAEKAAVESLTEMLQSYLSEIGRSAKSYCEHTARTQPTLPDIVVTLIEMG 91

  Fly    73 IKVGELKAMYEGQPDSLVLVECNAPETQDQDFHSVPQPVLSSTKAVELAST----TYIPDHLPPF 133
            ..|..|.| |..:...:|:   .||...:       .||:  .||:.....    .:||.|.|.|
 Frog    92 FNVES
LPA-YAKRSQRMVI---TAPPVTN-------NPVV--PKALSAGQNKQHPAHIPSHFPEF 143

  Fly   134 PGAHTY-KSSTI-EKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLFEETQRDGSGHVL 196
            |..||| |:.|. |.|.|  |..:|.:.|....:.:.||.::..:.....|||::   |.|...|
 Frog   144 PDPHTYIKTPTYREPVCD--YQVLREKAASQRRDVERALTRFMAKTGETQSLFKD---DTSTFPL 203

  Fly   197 DLGPPKKLPYSDALMPR----NQVFDTDIYAPIEVITHKALDCRYLEKPKLHSSRPSSGNFEEED 257
            ....|..:||.:||:|.    .||.:||        :.:..|....|...:|......|..:|..
 Frog   204 IAARPLSIPYLNALLPSELELQQVEETD--------SSEQDDQTDAENLSMHLQGDEVGMEKENS 260

  Fly   258 VEMEEPCSPGG 268
            ..:::....||
 Frog   261 SVLQQNSMKGG 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 19/69 (28%)
TAF8 125..177 CDD:176263 19/54 (35%)
taf8XP_012818203.1 Bromo_TP 22..96 CDD:284856 19/69 (28%)
TAF8 134..187 CDD:176263 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C210130858
eggNOG 1 0.900 E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1290064at2759
OrthoFinder 1 1.000 FOG0002683
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.