DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and taf8

DIOPT Version :8

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_005162360.1 Gene:taf8 / 393256 ZFINID:ZDB-GENE-040426-1013 Length:308 Species:Danio rerio

Alignment Length:267 Identity:64/268 (24%)
Similarity:111/268 (41%) Gaps:31/268 (12%)


  Fly     8 LATVLDNLLASKNCEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLERTFIRMN 72
            |..|:..||.....:..:..:.:::.|:::....|:.|.......|..|..|:..|:..|.:.|.
Zfish    39 LQVVVSALLTECGFDSAEKAVVETLTEMMQSYITEVGRCAKANCEHTARSTPTLSDVVITLVEMG 103

  Fly    73 IKVGELKAMYEGQPDSLVLVE---CNAPETQDQDFHSVPQPVLSSTKAVELASTTYIPDHLPPFP 134
            ..|..| .:|..:...:|:..   .|||        .||:.:.:..|....|   :||.|.|.||
Zfish   104 FNVDT
L-PVYAKRSQRMVITAPPITNAP--------VVPKSLTAGQKRTHPA---HIPSHFPDFP 156

  Fly   135 GAHTY-KSSTI-EKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLFEETQRDGSGHVLD 197
            ..||| ::.|. |.|:|  |..:|.:.|....:.:.||.::..:.....|||::   |.|...|.
Zfish   157 DPHTYIRTPTFREPVSD--YQVVREKAASQRRDVERALTRFMAKTGETQSLFKD---DISAFPLI 216

  Fly   198 LGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDCRYLEKPKLHSSRPSSGNFEEEDVEMEE 262
            ...|..:||..||:|.    :.::.:..|..:.:..|....:....|..:..||..:|.:|    
Zfish   217 AAKPSPIPYLSALLPS----ELELQSLEETDSSEQDDQMDNDNNTSHIMQDDSGADKENEV---- 273

  Fly   263 PCSPGGL 269
             ..|||:
Zfish   274 -LPPGGV 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 14/69 (20%)
TAF8 125..177 CDD:176263 18/54 (33%)
taf8XP_005162360.1 Bromo_TP 32..108 CDD:284856 14/69 (20%)
TAF8 146..199 CDD:176263 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C210128670
eggNOG 1 0.900 E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1290064at2759
OrthoFinder 1 1.000 FOG0002683
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46469
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.