DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and ZK1320.7

DIOPT Version :8

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_496087.2 Gene:ZK1320.7 / 259457 WormBaseID:WBGene00014256 Length:371 Species:Caenorhabditis elegans

Alignment Length:234 Identity:46/235 (20%)
Similarity:77/235 (33%) Gaps:61/235 (26%)


  Fly    47 TTNWS---NHAGRCAPSYFDLERTFIR-MNIKVGELKAMYEGQPDSLVLVECNAPETQDQDFHSV 107
            |||:.   ...|...|....:|  |:| .|:...|...|.:.:.|   :...:.....|..|.|.
 Worm     3 TTNYQLPPQKLGNLNPEQVPVE--FVRAKNVGDAEKTEMSQKRDD---VQRASNSSINDSGFGSE 62

  Fly   108 PQPVLSSTKAVELASTTYIPDHLPPFPGAHTYKSSTIEKVTDRSYVAMRNRHAENELNTQNALNQ 172
            .:.|:...|..|...   |....|       .:.:.|..:.|..:..::|..:.:..|       
 Worm    63 YRKVIEKAKIREKKK---IKTENP-------QEDAEIIILDDDDFAIVKNEPSTSHSN------- 110

  Fly   173 YYLRCNPNISLFEETQRDGSGHVLDLGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDCRY 237
            :.:|   :::.|.:..:||:...:.....||:|          :..||.|.      ..|..|  
 Worm   111 FNVR---DVNGFLKAAKDGNLEEIKRYLEKKIP----------IDVTDFYG------WTATMC-- 154

  Fly   238 LEKPKLHSSRPSSGNFEEEDVEMEEPCSPG-----GLGI 271
                     ....||||...:.:|....||     .|||
 Worm   155 ---------AAGEGNFEVCKLLLEHGADPGVRDSHSLGI 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 9/34 (26%)
TAF8 125..177 CDD:176263 7/52 (13%)
ZK1320.7NP_496087.2 ANK <109..200 CDD:238125 23/114 (20%)
ANK repeat 117..145 CDD:293786 7/38 (18%)
Ank_2 119..206 CDD:289560 21/94 (22%)
ANK repeat 147..178 CDD:293786 10/48 (21%)
G-patch 263..307 CDD:279867
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.