DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and taf-3

DIOPT Version :8

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001257272.1 Gene:taf-3 / 181704 WormBaseID:WBGene00006384 Length:1007 Species:Caenorhabditis elegans

Alignment Length:172 Identity:47/173 (27%)
Similarity:64/173 (37%) Gaps:25/173 (14%)


  Fly    35 LLRGKFREIARQTTNWSNHAGRCAPSYFDLERTFIRMNIKVGELKAMYEGQPDSLVLVECNAPET 99
            |||.|..|.|..|..:...|||..|...|:...|....:.:.:||. |..|..|.:|........
 Worm    44 LLRSKINEYAHSTRAFMELAGRTKPVTNDVIAAFKHQKVSLPDLKD-YAKQVKSEMLHALPVIPV 107

  Fly   100 QDQD--------FHSV--PQPVLSSTKAVELASTTYIPDHLPPFPGAHT--YKSSTIEKVTD--- 149
            .||:        |.|:  |:|   |.|.:| ....:||.|   |...|.  .:....||..|   
 Worm   108 PDQEIAKSDDNFFRSMYGPKP---SEKELE-ERREHIPSH---FRALHPEWIEEENKEKPPDDTG 165

  Fly   150 -RSYVAMRNRHAENELNTQNALNQYYLRCNPNI-SLFEETQR 189
             |..|.......::|.|....:|.|....||.: ...||.:|
 Worm   166 TRKVVKSAEEREQDEFNKLKRINTYRRNENPEVQQAREEKER 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 13/42 (31%)
TAF8 125..177 CDD:176263 14/58 (24%)
taf-3NP_001257272.1 BTP 11..86 CDD:128846 13/42 (31%)
PHD_TAF3 931..976 CDD:276997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.