DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and taf-8

DIOPT Version :8

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001022514.1 Gene:taf-8 / 174524 WormBaseID:WBGene00006390 Length:497 Species:Caenorhabditis elegans

Alignment Length:185 Identity:45/186 (24%)
Similarity:80/186 (43%) Gaps:15/186 (8%)


  Fly     4 YDEVLATVLDNLLASKNCEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLERTF 68
            |..||..::..:......:.:::...::::.|.....:.|..|:......|||...:..|:....
 Worm    69 YHNVLEQIVTAMCYKSGFDDIEEGALETLMLLFHSYIKRIGEQSRFACEVAGRTIVTPGDVWFGL 133

  Fly    69 IRMNIKVGELKAMYEGQPDSLVLV---ECNAPETQDQDFH-SVPQPVLSSTKAVELASTTYIPDH 129
            :.|.|||.:|...::.|..|.:.|   |...||.::|... ..|:|           ..:|:.:.
 Worm   134 VNMGIKVNQLSDFHQDQIISALTVHAPEIIPPEAKNQALRIGTPRP-----------HPSYVYEW 187

  Fly   130 LPPFPGAHTYKSSTIEKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLF 184
            |||.|..|||..:.|.:..|.||..:|...::.:.|...:|..|.:|..|:|.||
 Worm   188 LPPLPDPHTYIKTEISEDIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICLF 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 13/71 (18%)
TAF8 125..177 CDD:176263 17/52 (33%)
taf-8NP_001022514.1 BTP 66..142 CDD:128846 14/73 (19%)
TAF8 182..235 CDD:176263 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C210124938
eggNOG 1 0.900 E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002683
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46469
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.