DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and cbx8

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001072443.1 Gene:cbx8 XenbaseID:XB-GENE-977527 Length:362 Species:Xenopus tropicalis

Alignment Length:406 Identity:105/407 (26%)
Similarity:166/407 (41%) Gaps:104/407 (26%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYE--QTNKSSGTPSKRGI 87
            |:|||.::::|::||.:||.||||||:|:|:|||||.||||.||:..:|  :..:....|.||| 
 Frog    10 VFAAESLLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLVAAFEDREREREMYGPKKRG- 73

  Fly    88 KKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHD--KESKKEKKHHHHHHHHHHIKSERNS 150
                    |:|:      ||    :...||..::.|::  .||.:..:..:..|....:.|....
 Frog    74 --------PKPK------TF----LLKAQAKANAKTYEFRSESTRGVRIPYPGHPPQELPSRSRE 120

  Fly   151 GRRSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSNSSSSEDQPL-IGTKRK--- 211
            |.||                   |..||..:|:...:.|...........|..|: |..|:|   
 Frog   121 GLRS-------------------IPTSSQGSSATRGDIFSERLGRTEMRGEHYPMKIKRKKKHHS 166

  Fly   212 AEVLKESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQDQQQAEKI-ASEAATQLKSEQQATP 275
            .:.|.|.|...:.|.|:     |.....:.||.|.:   .|...|.|. |..:..|| :.:|.|.
 Frog   167 DKGLCEVGNQAIRISTA-----ISSNQLETVTGSAR---TDNPSAGKYHAPHSVIQL-ARRQDTD 222

  Fly   276 LATEAINTTPAESGAEEEEVANEEGNQQAPQVPSEN------------------NNIPKPCNNLA 322
            |...: :..|  .....|....:.|.....|:.::|                  :::.:..|:|.
 Frog   223 LGPSS-HVGP--GFMHRERALTQTGQDIQEQLSTDNHPHRTKHRVDFMASVCKESSVSRSRNSLG 284

  Fly   323 INQ---------------------KQPLTPL--SPRALPPRFWLPAKCNISNRVVITDVTVNLET 364
            ..:                     :.|:..:  .|...|   |.|...|. .:||:||||.|..|
 Frog   285 YQEQISDFYRGALGTHGGKPSLIARIPVARILGEPEEEP---WRPPVENF-EKVVVTDVTSNFLT 345

  Fly   365 VTIRECKTERGFFRER 380
            |||:|..|::|||:|:
 Frog   346 VTIKESNTDQGFFKEK 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 29/54 (54%)
cbx8NP_001072443.1 CHROMO 10..62 CDD:214605 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4486
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001702
OrthoInspector 1 1.000 T600766
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.910

Return to query results.
Submit another query.