DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and cbx6

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001016617.1 Gene:cbx6 XenbaseID:XB-GENE-951161 Length:361 Species:Xenopus tropicalis

Alignment Length:408 Identity:107/409 (26%)
Similarity:156/409 (38%) Gaps:124/409 (30%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGT--PSKRGI 87
            |:|||.|:::|::||.:||.||||||..:|:|||||.||||.|||..:||..:....  |.|||.
 Frog    10 VFAAESIMKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIVAFEQKEREQEIYGPKKRGP 74

  Fly    88 KKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGR 152
            |.|........::|    ....|||                              |...:..|  
 Frog    75 KPKTFLMKARAQAE----ALRLNDV------------------------------HFTMKPGS-- 103

  Fly   153 RSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSNSSS-------------SEDQP 204
             |.||..|.....|...|..|..||.|...       :|.||..:.|             ||...
 Frog   104 -SPSPKLHSSAAVHRLKKDIRRCHSMSRRP-------LPRPDPTAPSGTGSGMRPPVSPFSETVR 160

  Fly   205 LIGTKRKAEVLKESGKIGVTIKTSPDG---PTIKPQPTQQVTPSQQQPF-QDQQQAEKIASEAAT 265
            :|..|.|....|.: :|.:.:|....|   |..:|:     .||:.:.. :.::.:|.:......
 Frog   161 IINRKAKPREPKRN-RIILNLKVIDKGTKAPLGRPK-----IPSRNRVIGKSKKYSESMLRNQIR 219

  Fly   266 QLKSEQQATPLATEAINTTPA---ESGAEEEEVANEEGNQQAPQVPSENNNIPKPCNNLAINQKQ 327
            .||       ....::...||   ...|::.:.|.:||       .:::::....|.:.|.:..:
 Frog   220 HLK-------YGAFSLYNNPALQDPGAAKDGDEATQEG-------LADDSSSTSGCPSPAPSDDR 270

  Fly   328 P--LTP--LSPR------------ALPPRF--------------------WLPAKCNISNRVVIT 356
            |  |.|  |||.            ::||..                    |.|.....|| ||:|
 Frog   271 PPKLMPETLSPAVPDWRESEALDLSIPPESSASKRGQGEPEESDVDETGDWRPDMSPCSN-VVVT 334

  Fly   357 DVTVNLETVTIRE-CKTE 373
            |||.||.||||:| |..:
 Frog   335 DVTSNLLTVTIKEFCNAQ 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 31/52 (60%)
cbx6NP_001016617.1 CHROMO 10..62 CDD:214605 31/52 (60%)
CBX7_C 320..351 CDD:319236 18/32 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 1 1.000 FOG0001702
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.