DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and Cbx7

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006242082.1 Gene:Cbx7 RGDID:735027 Length:251 Species:Rattus norvegicus

Alignment Length:369 Identity:91/370 (25%)
Similarity:127/370 (34%) Gaps:138/370 (37%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKK 89
            |:|.|.|.:|||:||.|||.||||||..:|:|||||.:|||.||:..||:               
  Rat    10 VFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEE--------------- 59

  Fly    90 KEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGRRS 154
                                                    ||:|             :|.||.|.
  Rat    60 ----------------------------------------KEEK-------------DRASGYRK 71

  Fly   155 ESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPE--------PDSNSSSSEDQPLIGTKRK 211
            ..|          :.||..:....|.:...:|.:...|        |..|.|     |....|..
  Rat    72 RGP----------KPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLACPLGNGS-----PKGVVKAG 121

  Fly   212 AEVLKESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQDQQQAEKIASEAATQLKSEQQATPL 276
            |..|.|.|.:|.|:..    |..||....:......:.|          ....:.|:|......|
  Rat   122 AAELVEKGPLGPTLPF----PLRKPHKAHKYLRLSHKKF----------PPCGSHLESHSHRREL 172

  Fly   277 ATEAINTTPAESGAEE--EEVANEEGNQQAPQVPSENNNIPKPCNNLAINQKQPLTPLSPRALPP 339
            :.:       ||.|.:  :...:.|..:|.|:..:|.:         ..|...|.||:.|     
  Rat   173 SLQ-------ESAAPDVLQATGDWEPVEQPPEEEAEAD---------LTNGPPPWTPMLP----- 216

  Fly   340 RFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFFRERDMK 383
                      |:.|.:||:|.|..|||.||.:...||||:|..|
  Rat   217 ----------SSEVTVTDITANSVTVTFREAQAAEGFFRDRSGK 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 31/52 (60%)
Cbx7XP_006242082.1 CHROMO 10..62 CDD:214605 33/107 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4552
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T617792
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.920

Return to query results.
Submit another query.