DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and Cbx6

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006242056.1 Gene:Cbx6 RGDID:1307314 Length:414 Species:Rattus norvegicus

Alignment Length:433 Identity:104/434 (24%)
Similarity:152/434 (35%) Gaps:135/434 (31%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGT--PSKRGI 87
            |:|||.||::|::||.:||.||||||..:|:|||||.||||.|||..:||..:....  |.|||.
  Rat    10 VFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGP 74

  Fly    88 KKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGR 152
            |.|........::|....:      |.|.:...||     |....|.|.....|...|..|...|
  Rat    75 KPKTFLLKARAQAEALRIS------DVHFSVKPSA-----SASSPKLHSSAAVHRLKKDIRRCHR 128

  Fly   153 RSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSN----------SSSSEDQPLIG 207
            .|..||                                |.||..          |..||...:|.
  Rat   129 MSRRPL--------------------------------PRPDPQGGNPGLRPPISPFSETVRIIN 161

  Fly   208 TKRKAEVLKESGKIGVTIKTSPDGP-----------TIKPQ-PTQQVTPSQQQPFQDQQQAEKI- 259
            .|.|....|.: :|.:.:|....||           ..:|: |::.....:.:.|.:.....:| 
  Rat   162 RKVKPREPKRN-RIILNLKVIDKGPGGGSTAQGTGALARPKVPSRNRVIGKSKKFSESMLRTQIR 225

  Fly   260 -----------------------ASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVANEEGN 301
                                   .::.|:.......|||.|......:.:.||.....:.:.:.:
  Rat   226 HMKFGTFALYKPPPAPLVPSTAGKADVASSGPGLLLATPAAAPFDAHSSSSSGCPSPTLQSSDPD 290

  Fly   302 QQAPQVPSENNNIPKPCNNLAINQKQ---------PLTPLSPRALPPRF---------------- 341
            ...|::      :|:..:..|.|.::         |....:.:.:||..                
  Rat   291 DAPPKL------LPETISRSASNWRESEVLDLSIPPEAAATGQRVPPDVTAAAGQALHTVLEATG 349

  Fly   342 ----------WLPAKCNISNRVVITDVTVNLETVTIRE-CKTE 373
                      |.|.....|| ||:||||.||.||||:| |..|
  Rat   350 TGSSEPEAGDWRPEMSPCSN-VVVTDVTSNLLTVTIKEFCSPE 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 32/52 (62%)
Cbx6XP_006242056.1 CHROMO 10..62 CDD:214605 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 1 1.000 FOG0001702
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.