DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and Cbx2

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001100541.1 Gene:Cbx2 RGDID:1588561 Length:523 Species:Rattus norvegicus

Alignment Length:511 Identity:113/512 (22%)
Similarity:178/512 (35%) Gaps:161/512 (31%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQT------------NK 77
            |:|||.|:.||::||.:||.|||:||:.::|:||||.||||.||:..:::.            .:
  Rat    11 VFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKR 75

  Fly    78 SSGTPSKRGI------KKKEKEPD----------------PEPESEEDEYTFTENDVDTHQATTS 120
            ..|.|.|..:      :.|.||||                ....|:|:|....::|:|:.:.:..
  Rat    76 PRGRPRKHTVMSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEEEDDDDSDLDSKRGSRG 140

  Fly   121 SATHDKESKKE---------KKHHHHHHHHHHIKSERNSGRRSES-------------------- 156
            ..||....||.         |...........:..|:.:.||..|                    
  Rat   141 RETHPVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKAARRPVSLAKVLKTTRKDLVTSAPKLP 205

  Fly   157 -PLT-----------HHHHHHHHESKRQRIDH---------SSSSNSSFTHNSFVPEPDSNSSSS 200
             ||:           |........|.....::         .|.|....:..|.:....:..|.|
  Rat   206 PPLSAPVAGLAALKAHTKEACGGPSTMATPENLASLMKGMAGSPSRGGISWQSSIVHYMNRMSQS 270

  Fly   201 EDQPLIGTKRKAE------------VLKESGKIGVT-----IKTSPDGPTIKPQ-------PTQQ 241
            :.|.......||:            |..:.|::||.     :..:|.....:.|       |..|
  Rat   271 QAQAASRLALKAQAANKCSLGPDLKVRTQKGELGVNPAGSKVPKAPGSVAAEQQRGNNSGSPGSQ 335

  Fly   242 VTPSQQQPFQ--DQQQAEK------IASEAATQLKSEQQATPLAT--------EAINTTPAESGA 290
            :.|:|:...|  |.|..:.      :.:..||..|: ..||..||        ..:|.|.|.:..
  Rat   336 LPPTQELSLQVLDLQSVKNGVPGVGLPARHATATKA-IPATNTATGKGPGSGPTGVNVTNAPTDT 399

  Fly   291 EEEEVAN--------------------EEGNQQAPQVPSENNNIPKPCNNLAINQKQPLTPLSP- 334
            .:.|...                    ..|.|:...||.|....|..| .|:..::...:...| 
  Rat   400 SKGEKLTCKTAALPAPSVKRDAAKSIAASGGQEGHTVPGEGQKPPALC-ELSTGEENSSSDSDPD 463

  Fly   335 -RALP------------PRFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFF 377
             .:||            .:.|.|.: ::...|.:||||.||.|||::|..|..|||
  Rat   464 SSSLPSAGQNLSVAVQTSQDWKPTR-SLIEHVFVTDVTANLITVTVKESPTSVGFF 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 27/64 (42%)
Cbx2NP_001100541.1 Chromo 15..61 CDD:278797 24/46 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4552
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T617792
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.