DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and CBX7

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_783640.1 Gene:CBX7 HGNCID:1557 Length:251 Species:Homo sapiens

Alignment Length:387 Identity:98/388 (25%)
Similarity:128/388 (33%) Gaps:174/388 (45%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKK 89
            |:|.|.|.:|||:||.|||.||||||..:|:|||||.:|||.||:..||                
Human    10 VFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYE---------------- 58

  Fly    90 KEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGRRS 154
             |||                                                   :.:|.||.|.
Human    59 -EKE---------------------------------------------------ERDRASGYRK 71

  Fly   155 ESPLTHHHHHHHHESKRQRIDHSSSSNSSFTH----------------NSFVPEPDSNSSSSE-- 201
            ..|          :.||..:....|.:...:|                .|..||....:.:.|  
Human    72 RGP----------KPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELV 126

  Fly   202 DQ-PLIGT-------KRKA-EVLKESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQDQQQAE 257
            |: ||:.|       .||| :.|:.|.|     |..|.||.::....::....|:.|..|..|| 
Human   127 DKGPLVPTLPFPLRKPRKAHKYLRLSRK-----KFPPRGPNLESHSHRRELFLQEPPAPDVLQA- 185

  Fly   258 KIASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVAN-EEGNQQAPQVPSENNNIPKPCNNL 321
                                  |....||....|||..|: .||                     
Human   186 ----------------------AGEWEPAAQPPEEEADADLAEG--------------------- 207

  Fly   322 AINQKQPLTPLSPRALPPRFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFFRERDMK 383
                ..|.||    |||           |:.|.:||:|.|..|||.||.:...||||:|..|
Human   208 ----PPPWTP----ALP-----------SSEVTVTDITANSITVTFREAQAAEGFFRDRSGK 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 31/52 (60%)
CBX7NP_783640.1 CHROMO 10..62 CDD:214605 34/120 (28%)
CBX7_C 209..240 CDD:319236 17/46 (37%)
Required for cellular lifespan extension 223..236 8/13 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4641
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608856
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2447
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.