DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pc and cec-1

Sequence 1:NP_524199.1 Gene:Pc FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_498862.1 Gene:cec-1 WormBaseID:WBGene00000414 Length:304 Species:Caenorhabditis elegans

Alignment Length:342 Identity:72/343 (21%)
Similarity:126/343 (37%) Gaps:113/343 (33%)


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIY----------------- 72
            :|..|.|::.|.|||..|:.:||.|::..:|:|||:.||:|..||:.:                 
 Worm     7 LYTVESILEHRKKKGKSEFYIKWLGYDHTHNSWEPKENIVDPTLIEAFFTREAARKAEIKAKKDK 71

  Fly    73 -------------EQTNKSSGTPSKRGIKKKEKEP--------------DPEPESEEDEYTFTEN 110
                         ...:|:|.:...||.|...|.|              |..|:|:.||      
 Worm    72 MAAGKKGASSKASASVSKASASTPARGAKAAPKPPPKKSPPKRQRLAGGDIRPDSDTDE------ 130

  Fly   111 DVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGRRSESPLTHHHHHHHHESKRQRID 175
               .|    |||  ||:||.|               :.......|.|:         ..|::.:.
 Worm   131 ---EH----SSA--DKKSKAE---------------DEEEVEDDEEPV---------PKKKKEVQ 162

  Fly   176 HSSSSNSSFTHNSFVPEPDSNSS-SSEDQPLIGTKRKAEVLKESGKIGVTIKTSPDGPTIKPQPT 239
            .               ||:...| ..||:.   ..::.|.|||..|:....|...:...::.:..
 Worm   163 E---------------EPEEEESVEGEDEE---ESQEVEDLKEDEKMEEDEKEEEEDVQLESEKN 209

  Fly   240 QQVTPSQQQPFQDQQQAEKIASEAATQLKSEQQA---TPLATEAINT-TPAESGAEEEEVANEEG 300
            ::  ..:::..:::::.|:...|...||...::.   |.:...|:.| .|:|..:.|:.|. |.|
 Worm   210 EK--EEEEEKVEEKKEEEEEEEEEEIQLVIVEKTVIETTIVEPAVATPEPSEPSSSEKAVV-ENG 271

  Fly   301 NQQAPQVPSENNNIPKP 317
            :..|    :..|:..||
 Worm   272 SSSA----AAGNSASKP 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 20/82 (24%)
cec-1NP_498862.1 CHROMO 8..59 CDD:214605 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4001
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2447
TreeFam 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.